General information for g10046.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g10046 is located on chr_1: 7023300..7023621 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10046 | g10046.t1 | TTS | g10046.t1 | 7023219 | 7023219 |
| chr_1 | g10046 | g10046.t1 | isoform | g10046.t1 | 7023300 | 7023621 |
| chr_1 | g10046 | g10046.t1 | exon | g10046.t1.exon1 | 7023300 | 7023384 |
| chr_1 | g10046 | g10046.t1 | cds | g10046.t1.CDS1 | 7023300 | 7023384 |
| chr_1 | g10046 | g10046.t1 | exon | g10046.t1.exon2 | 7023446 | 7023621 |
| chr_1 | g10046 | g10046.t1 | cds | g10046.t1.CDS2 | 7023446 | 7023621 |
| chr_1 | g10046 | g10046.t1 | TSS | g10046.t1 | 7023674 | 7023674 |
Sequences
>g10046.t1 Gene=g10046 Length=261
ATGAGTGATTTTCCTGATCGGCAGACAAGGACAGCATGCTGGGAAGCAAGAGATAAATAT
TGGGAATGTTTAGATAAATATGCACCTAATTTCAATAGAAATAATACCTCAGAGAAGGAA
CCAAAAGAGTGTGAAAAATTACGAAAGGCTTTTGTATCTGGATGTCCTTCACAATGGGTA
AAACATTTTGATAGAAAAAGAACGTATGAATTATTTAAACAACGAATGGAAAAGGGTTTT
GATCCATTAGAACAGAAATAA
>g10046.t1 Gene=g10046 Length=86
MSDFPDRQTRTACWEARDKYWECLDKYAPNFNRNNTSEKEPKECEKLRKAFVSGCPSQWV
KHFDRKRTYELFKQRMEKGFDPLEQK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g10046.t1 | Gene3D | G3DSA:1.10.10.140 | Cytochrome C oxidase subunit h | 2 | 76 | 0.000013 |
| 2 | g10046.t1 | PANTHER | PTHR46690 | CYTOCHROME C OXIDASE ASSEMBLY FACTOR 6 HOMOLOG | 4 | 84 | 0.000000 |
| 1 | g10046.t1 | Pfam | PF02297 | Cytochrome oxidase c subunit VIb | 3 | 76 | 0.000000 |
| 5 | g10046.t1 | ProSiteProfiles | PS51808 | Coiled coil-helix-coiled coil-helix (CHCH) domain profile. | 10 | 63 | 12.036000 |
| 3 | g10046.t1 | SUPERFAMILY | SSF47694 | Cytochrome c oxidase subunit h | 3 | 74 | 0.000000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0045277 | respiratory chain complex IV | CC |
| GO:0008535 | respiratory chain complex IV assembly | BP |
| GO:0005739 | mitochondrion | CC |
KEGG
Orthology
- This transcript has been annotated with K18179 (cytochrome c oxidase assembly factor 6)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
