General information for g10135.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g10135 is located on chr_1: 7689612..7689920 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10135 | g10135.t1 | isoform | g10135.t1 | 7689612 | 7689920 |
| chr_1 | g10135 | g10135.t1 | exon | g10135.t1.exon1 | 7689612 | 7689637 |
| chr_1 | g10135 | g10135.t1 | cds | g10135.t1.CDS1 | 7689612 | 7689637 |
| chr_1 | g10135 | g10135.t1 | exon | g10135.t1.exon2 | 7689689 | 7689920 |
| chr_1 | g10135 | g10135.t1 | cds | g10135.t1.CDS2 | 7689689 | 7689920 |
| chr_1 | g10135 | g10135.t1 | TSS | g10135.t1 | NA | NA |
| chr_1 | g10135 | g10135.t1 | TTS | g10135.t1 | NA | NA |
Sequences
>g10135.t1 Gene=g10135 Length=258
ATGGTTTTTGTCAGTCAACTTGCTGTGAGTCATTGTGTTTGGCTTATCAATTATTATGCT
CATAAATTTGGTTATAAATCTTTTGACAAATATATGAATGCAACTGATTCTTATACTTTA
AACTTTTTATTGCTTGGTGAATGTTTTCATAATTATCATCATGTATTTCCTTATGTTTAT
CGTTCGTCAGAATATGGAACACGTTGGAGCAATTTTACAACATCATTTATAGACTTTTTG
TCGAAAATTGGTATGTAA
>g10135.t1 Gene=g10135 Length=85
MVFVSQLAVSHCVWLINYYAHKFGYKSFDKYMNATDSYTLNFLLLGECFHNYHHVFPYVY
RSSEYGTRWSNFTTSFIDFLSKIGM
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value |
|---|---|---|---|---|---|---|
| g10135.t1 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 5 | 85 | 0 |
| g10135.t1 | PANTHER | PTHR11351:SF31 | RE43130P | 5 | 85 | 0 |
| g10135.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 3 | 24 | 0 |
| g10135.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 46 | 60 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed