General information for g10176.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Ubiquitin-conjugating enzyme E2-17 kDa.
Parent gene
- The parent gene g10176 is located on chr_1: 8078898..8079745 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10176 | g10176.t1 | TSS | g10176.t1 | 8077086 | 8077086 |
| chr_1 | g10176 | g10176.t1 | isoform | g10176.t1 | 8077317 | 8079012 |
| chr_1 | g10176 | g10176.t1 | exon | g10176.t1.exon1 | 8077317 | 8077360 |
| chr_1 | g10176 | g10176.t1 | cds | g10176.t1.CDS1 | 8077317 | 8077360 |
| chr_1 | g10176 | g10176.t1 | exon | g10176.t1.exon2 | 8078537 | 8078822 |
| chr_1 | g10176 | g10176.t1 | cds | g10176.t1.CDS2 | 8078537 | 8078822 |
| chr_1 | g10176 | g10176.t1 | exon | g10176.t1.exon3 | 8078887 | 8079012 |
| chr_1 | g10176 | g10176.t1 | cds | g10176.t1.CDS3 | 8078887 | 8079012 |
| chr_1 | g10176 | g10176.t1 | TTS | g10176.t1 | 8079723 | 8079723 |
Sequences
>g10176.t1 Gene=g10176 Length=456
ATGTCAACTCCAGCTAGAAGACGATTAATGCGAGATTTCAAAAGACTTCAAGAAGATCCA
CCTACAGGAGTCTCAGGTGCGCCAACCGATAATAACATAATGATATGGAATGCTGTGATT
TTTGGTCCGCATGATACACCCTTTGAAGATGGAACTTTCAAATTGACGATAGAATTCACT
GAAGAATATCCAAATAAACCACCAACAGTTCGTTTTGTGTCGAAAATGTTTCATCCAAAT
GTTTATGCTGATGGTGGCATTTGCTTGGATATCTTACAAAACAGATGGAGTCCAACTTAT
GACGTATCTGCCATATTAACATCTATACAGTCACTTCTGAGTGATCCCAATCCAAACTCA
CCTGCTAATGCTATGGCAGCTCAGTTGTATAAAGAAAATCGTCGGGAATATGAGAAACGG
GTCAAGGCATGTGTGGAACAAAGCTTCATTGATTAG
>g10176.t1 Gene=g10176 Length=151
MSTPARRRLMRDFKRLQEDPPTGVSGAPTDNNIMIWNAVIFGPHDTPFEDGTFKLTIEFT
EEYPNKPPTVRFVSKMFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNS
PANAMAAQLYKENRREYEKRVKACVEQSFID
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g10176.t1 | CDD | cd00195 | UBCc | 7 | 145 | 5.31455E-75 |
| 6 | g10176.t1 | Coils | Coil | Coil | 127 | 147 | - |
| 5 | g10176.t1 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 1 | 151 | 2.7E-69 |
| 2 | g10176.t1 | PANTHER | PTHR24067:SF260 | UBIQUITIN-CONJUGATING ENZYME E2 A,-LIKE | 1 | 151 | 1.8E-91 |
| 3 | g10176.t1 | PANTHER | PTHR24067 | UBIQUITIN-CONJUGATING ENZYME E2 | 1 | 151 | 1.8E-91 |
| 1 | g10176.t1 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 8 | 144 | 4.4E-54 |
| 8 | g10176.t1 | ProSitePatterns | PS00183 | Ubiquitin-conjugating enzymes active site. | 77 | 92 | - |
| 10 | g10176.t1 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 7 | 139 | 47.115 |
| 9 | g10176.t1 | SMART | SM00212 | ubc_7 | 7 | 150 | 1.1E-74 |
| 4 | g10176.t1 | SUPERFAMILY | SSF54495 | UBC-like | 1 | 149 | 1.02E-61 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K10573 (ubiquitin-conjugating enzyme E2 A)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
