Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Thiamine transporter 1.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g10216 g10216.t2 TSS g10216.t2 8268233 8268233
chr_1 g10216 g10216.t2 isoform g10216.t2 8268356 8268985
chr_1 g10216 g10216.t2 exon g10216.t2.exon1 8268356 8268567
chr_1 g10216 g10216.t2 cds g10216.t2.CDS1 8268356 8268567
chr_1 g10216 g10216.t2 exon g10216.t2.exon2 8268630 8268770
chr_1 g10216 g10216.t2 cds g10216.t2.CDS2 8268630 8268770
chr_1 g10216 g10216.t2 exon g10216.t2.exon3 8268825 8268985
chr_1 g10216 g10216.t2 cds g10216.t2.CDS3 8268825 8268984
chr_1 g10216 g10216.t2 TTS g10216.t2 8269917 8269917

Sequences

>g10216.t2 Gene=g10216 Length=514
ATGCAGCAGTGGCTAAAAATTTCTCTAGCTCTTTGTTCTTTTGGATTCTTCAGAGAGTTT
AGACCTTCAGAGCCATTTGTTACTAATTTTTTAACATCAACTAAATGGAGAAATTTAACT
GAAGATCAAATAAATTTTGAAGTTTATCCAGTCGGCACATATTCGACACTTACACTACTT
GTTTTCGTATTTTTAGTGACTGATATATTAAGATATAAACCAATTATCATCGCTTCATCA
TGTGCAGGTATAATTATTTGGTCGATTCTACTCTGGACTACATCATTACTTGCATTACAA
ATTTCACAATTCTTTTATGGGTTCTATATGGCAGCTGAAGTTGCATATTATACTTACATG
TATGCTAAAGTAGAAAAAAGTAAATATCAAAAAGTTACGGGAAACGCTCGCGCTGCTATA
TTGACTGGACGTTTTACATCAAGTGTAATTGCTCAACTTTTATATTCATTCGATATTATG
GATTTTAGAGAATTAAATTATTTAACACTTGGAG

>g10216.t2 Gene=g10216 Length=171
MQQWLKISLALCSFGFFREFRPSEPFVTNFLTSTKWRNLTEDQINFEVYPVGTYSTLTLL
VFVFLVTDILRYKPIIIASSCAGIIIWSILLWTTSLLALQISQFFYGFYMAAEVAYYTYM
YAKVEKSKYQKVTGNARAAILTGRFTSSVIAQLLYSFDIMDFRELNYLTLG

Protein features from InterProScan

Transcript Database ID Name Start End E.value
2 g10216.t2 PANTHER PTHR10686:SF36 AGAP006349-PA 1 171 5.6E-80
3 g10216.t2 PANTHER PTHR10686 FOLATE TRANSPORTER 1 171 5.6E-80
1 g10216.t2 Pfam PF01770 Reduced folate carrier 2 170 1.4E-73
12 g10216.t2 Phobius SIGNAL_PEPTIDE Signal peptide region 1 22 -
13 g10216.t2 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 6 -
14 g10216.t2 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 7 17 -
18 g10216.t2 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 18 22 -
11 g10216.t2 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 23 45 -
17 g10216.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 46 66 -
9 g10216.t2 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 67 74 -
16 g10216.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 75 98 -
10 g10216.t2 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 99 103 -
15 g10216.t2 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 104 122 -
8 g10216.t2 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 123 171 -
7 g10216.t2 SUPERFAMILY SSF103473 MFS general substrate transporter 51 156 4.32E-8
5 g10216.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 44 66 -
4 g10216.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 76 98 -
6 g10216.t2 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 105 122 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0090482 vitamin transmembrane transporter activity MF
GO:0051180 vitamin transport BP
GO:0016021 integral component of membrane CC

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values