| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10216 | g10216.t3 | TSS | g10216.t3 | 8268233 | 8268233 |
| chr_1 | g10216 | g10216.t3 | isoform | g10216.t3 | 8268356 | 8268985 |
| chr_1 | g10216 | g10216.t3 | exon | g10216.t3.exon1 | 8268356 | 8268567 |
| chr_1 | g10216 | g10216.t3 | cds | g10216.t3.CDS1 | 8268356 | 8268567 |
| chr_1 | g10216 | g10216.t3 | exon | g10216.t3.exon2 | 8268630 | 8268985 |
| chr_1 | g10216 | g10216.t3 | cds | g10216.t3.CDS2 | 8268630 | 8268774 |
| chr_1 | g10216 | g10216.t3 | TTS | g10216.t3 | 8269917 | 8269917 |
>g10216.t3 Gene=g10216 Length=568
ATGCAGCAGTGGCTAAAAATTTCTCTAGCTCTTTGTTCTTTTGGATTCTTCAGAGAGTTT
AGACCTTCAGAGCCATTTGTTACTAATTTTTTAACATCAACTAAATGGAGAAATTTAACT
GAAGATCAAATAAATTTTGAAGTTTATCCAGTCGGCACATATTCGACACTTACACTACTT
GTTTTCGTATTTTTAGTGACTGATATATTAAGATATAAACCAATTATCATCGCTTCATCA
TGTGCAGGTATAATTATTTGGTCGATTCTACTCTGGACTACATCATTACTTGCATTACAA
ATTTCACAATTCTTTTATGGGTTCTATATGGCAGCTGAAGTTGCATATTATACGTAAAAT
GATCTTATTAATTGCTAGTAATTGATACTAATTGTCTCAAATTTTAGTTACATGTATGCT
AAAGTAGAAAAAAGTAAATATCAAAAAGTTACGGGAAACGCTCGCGCTGCTATATTGACT
GGACGTTTTACATCAAGTGTAATTGCTCAACTTTTATATTCATTCGATATTATGGATTTT
AGAGAATTAAATTATTTAACACTTGGAG
>g10216.t3 Gene=g10216 Length=118
MQQWLKISLALCSFGFFREFRPSEPFVTNFLTSTKWRNLTEDQINFEVYPVGTYSTLTLL
VFVFLVTDILRYKPIIIASSCAGIIIWSILLWTTSLLALQISQFFYGFYMAAEVAYYT
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g10216.t3 | PANTHER | PTHR10686:SF36 | AGAP006349-PA | 1 | 118 | 4.2E-53 |
| 3 | g10216.t3 | PANTHER | PTHR10686 | FOLATE TRANSPORTER | 1 | 118 | 4.2E-53 |
| 1 | g10216.t3 | Pfam | PF01770 | Reduced folate carrier | 2 | 118 | 1.7E-50 |
| 10 | g10216.t3 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 22 | - |
| 11 | g10216.t3 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 6 | - |
| 12 | g10216.t3 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 7 | 17 | - |
| 16 | g10216.t3 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 18 | 22 | - |
| 8 | g10216.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 23 | 45 | - |
| 15 | g10216.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 46 | 67 | - |
| 7 | g10216.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 68 | 73 | - |
| 13 | g10216.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 74 | 92 | - |
| 9 | g10216.t3 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 93 | 97 | - |
| 14 | g10216.t3 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 98 | 117 | - |
| 6 | g10216.t3 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 118 | 118 | - |
| 5 | g10216.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 44 | 66 | - |
| 4 | g10216.t3 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 76 | 98 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0090482 | vitamin transmembrane transporter activity | MF |
| GO:0051180 | vitamin transport | BP |
| GO:0016021 | integral component of membrane | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.