| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10221 | g10221.t5 | TSS | g10221.t5 | 8339382 | 8339382 |
| chr_1 | g10221 | g10221.t5 | isoform | g10221.t5 | 8339466 | 8341564 |
| chr_1 | g10221 | g10221.t5 | exon | g10221.t5.exon1 | 8339466 | 8339535 |
| chr_1 | g10221 | g10221.t5 | cds | g10221.t5.CDS1 | 8339466 | 8339535 |
| chr_1 | g10221 | g10221.t5 | exon | g10221.t5.exon2 | 8341180 | 8341347 |
| chr_1 | g10221 | g10221.t5 | cds | g10221.t5.CDS2 | 8341180 | 8341347 |
| chr_1 | g10221 | g10221.t5 | exon | g10221.t5.exon3 | 8341422 | 8341564 |
| chr_1 | g10221 | g10221.t5 | cds | g10221.t5.CDS3 | 8341422 | 8341564 |
| chr_1 | g10221 | g10221.t5 | TTS | g10221.t5 | 8341894 | 8341894 |
>g10221.t5 Gene=g10221 Length=381
ATGGCTTGGGAAGGCAAAAAATACAAATTGGATAGACAAGAAAACTTCGAGGAATACATG
AAGAAGATTGGTGTTGGAATGGTTCTTCGTAAGATGGGAATGTCTGTTCATCCTACAGTT
TACCTTGTCAAGGATGGTGATGAATACAGTTTCCATACTGACTCAACTTTCAAAAATACC
GTCATGAAATTCAAGCTCGGAGAAGAATTTGAAAATGAAACATTGGATGGACGTAAAGTC
ACTCTCGATGGTAACACAATGACTCAGGTTGAGAAAGGTGAAAAGAAATCGGTGATTGTT
CGTGAATTCAGCGACAGTGAGGTCGTAGTCACATGTGAATATGATGGCGTAGTGAGCAAA
CGCTGGTACAAAGTTGTTTAA
>g10221.t5 Gene=g10221 Length=126
MAWEGKKYKLDRQENFEEYMKKIGVGMVLRKMGMSVHPTVYLVKDGDEYSFHTDSTFKNT
VMKFKLGEEFENETLDGRKVTLDGNTMTQVEKGEKKSVIVREFSDSEVVVTCEYDGVVSK
RWYKVV
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g10221.t5 | Gene3D | G3DSA:2.40.128.20 | - | 2 | 125 | 1.8E-44 |
| 2 | g10221.t5 | PANTHER | PTHR11955:SF135 | FATTY ACID BINDING PROTEIN, ISOFORM C | 3 | 124 | 3.5E-33 |
| 3 | g10221.t5 | PANTHER | PTHR11955 | FATTY ACID BINDING PROTEIN | 3 | 124 | 3.5E-33 |
| 5 | g10221.t5 | PRINTS | PR00178 | Fatty acid-binding protein signature | 4 | 26 | 4.0E-18 |
| 6 | g10221.t5 | PRINTS | PR00178 | Fatty acid-binding protein signature | 63 | 79 | 4.0E-18 |
| 4 | g10221.t5 | PRINTS | PR00178 | Fatty acid-binding protein signature | 105 | 125 | 4.0E-18 |
| 1 | g10221.t5 | Pfam | PF00061 | Lipocalin / cytosolic fatty-acid binding protein family | 7 | 119 | 3.5E-12 |
| 8 | g10221.t5 | ProSitePatterns | PS00214 | Cytosolic fatty-acid binding proteins signature. | 6 | 23 | - |
| 7 | g10221.t5 | SUPERFAMILY | SSF50814 | Lipocalins | 2 | 124 | 1.54E-36 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0008289 | lipid binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed