General information for g10250.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g10250 is located on chr_1: 8525970..8527067 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10250 | g10250.t1 | isoform | g10250.t1 | 8525970 | 8527067 |
| chr_1 | g10250 | g10250.t1 | exon | g10250.t1.exon1 | 8525970 | 8526161 |
| chr_1 | g10250 | g10250.t1 | cds | g10250.t1.CDS1 | 8525970 | 8526161 |
| chr_1 | g10250 | g10250.t1 | exon | g10250.t1.exon2 | 8526226 | 8526336 |
| chr_1 | g10250 | g10250.t1 | cds | g10250.t1.CDS2 | 8526226 | 8526336 |
| chr_1 | g10250 | g10250.t1 | exon | g10250.t1.exon3 | 8526391 | 8526786 |
| chr_1 | g10250 | g10250.t1 | cds | g10250.t1.CDS3 | 8526391 | 8526786 |
| chr_1 | g10250 | g10250.t1 | exon | g10250.t1.exon4 | 8526840 | 8527067 |
| chr_1 | g10250 | g10250.t1 | cds | g10250.t1.CDS4 | 8526840 | 8527067 |
| chr_1 | g10250 | g10250.t1 | TSS | g10250.t1 | NA | NA |
| chr_1 | g10250 | g10250.t1 | TTS | g10250.t1 | NA | NA |
Sequences
>g10250.t1 Gene=g10250 Length=927
ATGGAAGTCACATATATTTTAACGACTATTGAAATTATTATTGCAATTTTAGCCGGTATA
GGAAATACATTTGTAATTACAATATTCTTTAAAGATGAAAAGTTACGTAATCGTAAAATA
AATTCTTTGTTTGTATCACAAGCATTTTCTGACTTACTTGTCGGTATAATTGGAATACCA
TTAAATATTTTACTTTATTTAAAATTAGCAAATGAATTTTGTAAATTGACAATTTCAAAT
ATTATTGCTGTGAGAACAGTATCAATTAACAATGTATTATTAATATCCTTCGATCGATAC
AAGGCACTATCGCATCCTATAAAATATGCCGCTAAGCAATCTAAGTTTAGTTTGAAGATC
TCAATTTTTTCGAGCTGGTTTTTTGGACTTTTATTAGGATTCATAATATGTTTTTACAAT
AATGACAAACATGAAACAGAATGCACATTTAAAAATATAATAACTAGAGATTATGCATAT
TTTCTTCAATTTGTATCATCAGTTTTGCCATTCACAACTTTAGTTGTGATTTATTCTTAT
GTCTATCTAGCTATGAGAAAGGTTCATTTGAACCATACATGTGATACATGTGTTGATTTA
CAAAATTCGTCGAAAACTATATGTAAAATTCGAAGAAGAGAATTTCATGCCACTGTGAAT
ATGCTTGCAATTGTTGCAAGTTTTGCAATTTGTAAATTTCCATTATTGATTCTGCATTTG
ACGTATGAAATTTTTTATGAAGTTGAAAAAGATAAAAATCTTCAACAAGTTTTTATTGCA
ATTAATCATCTTACCACAATTATTAACCCGATTTTATATGCGCTAAAACTAAAGGATTTT
AGAAAATCATGTATCGAATTTTTAAGCATTGAAACAGAAAACAAAACATCTTTATACAAC
CGCAGTCAACAAAGAAATCACATTTAA
>g10250.t1 Gene=g10250 Length=308
MEVTYILTTIEIIIAILAGIGNTFVITIFFKDEKLRNRKINSLFVSQAFSDLLVGIIGIP
LNILLYLKLANEFCKLTISNIIAVRTVSINNVLLISFDRYKALSHPIKYAAKQSKFSLKI
SIFSSWFFGLLLGFIICFYNNDKHETECTFKNIITRDYAYFLQFVSSVLPFTTLVVIYSY
VYLAMRKVHLNHTCDTCVDLQNSSKTICKIRRREFHATVNMLAIVASFAICKFPLLILHL
TYEIFYEVEKDKNLQQVFIAINHLTTIINPILYALKLKDFRKSCIEFLSIETENKTSLYN
RSQQRNHI
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 27 | g10250.t1 | CDD | cd00637 | 7tm_classA_rhodopsin-like | 22 | 275 | 1.96526E-32 |
| 11 | g10250.t1 | Gene3D | G3DSA:1.20.1070.10 | - | 1 | 290 | 9.5E-47 |
| 2 | g10250.t1 | PANTHER | PTHR24247:SF239 | - | 5 | 285 | 1.1E-36 |
| 3 | g10250.t1 | PANTHER | PTHR24247 | 5-HYDROXYTRYPTAMINE RECEPTOR | 5 | 285 | 1.1E-36 |
| 9 | g10250.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 6 | 30 | 1.4E-21 |
| 6 | g10250.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 40 | 61 | 1.4E-21 |
| 5 | g10250.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 81 | 103 | 1.4E-21 |
| 4 | g10250.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 159 | 182 | 1.4E-21 |
| 8 | g10250.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 217 | 241 | 1.4E-21 |
| 7 | g10250.t1 | PRINTS | PR00237 | Rhodopsin-like GPCR superfamily signature | 255 | 281 | 1.4E-21 |
| 1 | g10250.t1 | Pfam | PF00001 | 7 transmembrane receptor (rhodopsin family) | 21 | 273 | 1.6E-35 |
| 18 | g10250.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 5 | - |
| 26 | g10250.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 6 | 30 | - |
| 15 | g10250.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 31 | 41 | - |
| 23 | g10250.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 42 | 66 | - |
| 19 | g10250.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 67 | 77 | - |
| 22 | g10250.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 78 | 97 | - |
| 14 | g10250.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 98 | 117 | - |
| 20 | g10250.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 118 | 141 | - |
| 17 | g10250.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 142 | 160 | - |
| 25 | g10250.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 161 | 183 | - |
| 12 | g10250.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 184 | 218 | - |
| 21 | g10250.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 219 | 242 | - |
| 16 | g10250.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 243 | 253 | - |
| 24 | g10250.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 254 | 275 | - |
| 13 | g10250.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 276 | 308 | - |
| 34 | g10250.t1 | ProSitePatterns | PS00237 | G-protein coupled receptors family 1 signature. | 87 | 103 | - |
| 35 | g10250.t1 | ProSiteProfiles | PS50262 | G-protein coupled receptors family 1 profile. | 21 | 273 | 31.325 |
| 10 | g10250.t1 | SUPERFAMILY | SSF81321 | Family A G protein-coupled receptor-like | 3 | 291 | 2.01E-39 |
| 28 | g10250.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 7 | 29 | - |
| 33 | g10250.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 44 | 66 | - |
| 29 | g10250.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 117 | 139 | - |
| 32 | g10250.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 159 | 181 | - |
| 31 | g10250.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 219 | 241 | - |
| 30 | g10250.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 256 | 275 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0007186 | G protein-coupled receptor signaling pathway | BP |
| GO:0016021 | integral component of membrane | CC |
| GO:0004930 | G protein-coupled receptor activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed