| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10334 | g10334.t45 | isoform | g10334.t45 | 8934473 | 8935590 |
| chr_1 | g10334 | g10334.t45 | exon | g10334.t45.exon1 | 8934473 | 8934696 |
| chr_1 | g10334 | g10334.t45 | cds | g10334.t45.CDS1 | 8934473 | 8934696 |
| chr_1 | g10334 | g10334.t45 | exon | g10334.t45.exon2 | 8934759 | 8934836 |
| chr_1 | g10334 | g10334.t45 | cds | g10334.t45.CDS2 | 8934759 | 8934836 |
| chr_1 | g10334 | g10334.t45 | exon | g10334.t45.exon3 | 8934917 | 8934967 |
| chr_1 | g10334 | g10334.t45 | cds | g10334.t45.CDS3 | 8934917 | 8934967 |
| chr_1 | g10334 | g10334.t45 | exon | g10334.t45.exon4 | 8935028 | 8935088 |
| chr_1 | g10334 | g10334.t45 | cds | g10334.t45.CDS4 | 8935028 | 8935055 |
| chr_1 | g10334 | g10334.t45 | exon | g10334.t45.exon5 | 8935429 | 8935590 |
| chr_1 | g10334 | g10334.t45 | TSS | g10334.t45 | 8935652 | 8935652 |
| chr_1 | g10334 | g10334.t45 | TTS | g10334.t45 | NA | NA |
>g10334.t45 Gene=g10334 Length=576
ATGAAATTACTTGTTTTTCTGTCATTTTTGTTTGTTGCTGAGTTGGCTCTCTCGGCTGAG
AGTGATGTTCTTGAATTGACTGATTCTGATTTTGAAACTACAATCAAAGAATATCCAACA
GTGTTGGCAATGGTAATATAAAATAATAATTACAATAATATACTTAAACCAGAATATGCC
AAAGCAGCAGAATTGATGAGAACTGATGATCCTCCAATTACTCTTGTCAAAGTTGATTGT
ACAGAAGGCGGCAAGGATACTTGCAGCAAATTCGGTGTTTCTGGATATCCCACTCTCAAA
ATTTTCAGAAACGGTGAAAATCCTCAGGATTATAATGGTCCACGTGAAGCAAGTGGTATT
GTGAAATATATGAGAGCACAAGTTGGTCCATCATCAAAGGATCTTCTAACAGTTGAAGCA
TATGAAAAGTTCTTGGGTGTTCAAGAGGGTGCCGTAGTTGGATTCTTTGAAAAAGAAACG
GATTTGAAGACTGTTTTCTTAAAATATGCCGATTTGCAACGTGAGAAACTTCGCTTTGCA
CATTCAAGTGATCCAGAAATTCTCAAGAAAGTTGGC
>g10334.t45 Gene=g10334 Length=127
MRTDDPPITLVKVDCTEGGKDTCSKFGVSGYPTLKIFRNGENPQDYNGPREASGIVKYMR
AQVGPSSKDLLTVEAYEKFLGVQEGAVVGFFEKETDLKTVFLKYADLQREKLRFAHSSDP
EILKKVG
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g10334.t45 | CDD | cd02961 | PDI_a_family | 4 | 59 | 0e+00 |
| 7 | g10334.t45 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin | 1 | 63 | 0e+00 |
| 6 | g10334.t45 | Gene3D | G3DSA:3.40.30.10 | Glutaredoxin | 64 | 127 | 0e+00 |
| 2 | g10334.t45 | PANTHER | PTHR18929:SF60 | PROTEIN DISULFIDE-ISOMERASE | 8 | 127 | 0e+00 |
| 3 | g10334.t45 | PANTHER | PTHR18929 | PROTEIN DISULFIDE ISOMERASE | 8 | 127 | 0e+00 |
| 1 | g10334.t45 | Pfam | PF00085 | Thioredoxin | 7 | 60 | 0e+00 |
| 5 | g10334.t45 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 4 | 64 | 0e+00 |
| 4 | g10334.t45 | SUPERFAMILY | SSF52833 | Thioredoxin-like | 68 | 126 | 2e-07 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed