| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10337 | g10337.t1 | TTS | g10337.t1 | 8936814 | 8936814 |
| chr_1 | g10337 | g10337.t1 | isoform | g10337.t1 | 8937700 | 8938102 |
| chr_1 | g10337 | g10337.t1 | exon | g10337.t1.exon1 | 8937700 | 8937944 |
| chr_1 | g10337 | g10337.t1 | cds | g10337.t1.CDS1 | 8937700 | 8937944 |
| chr_1 | g10337 | g10337.t1 | exon | g10337.t1.exon2 | 8938021 | 8938102 |
| chr_1 | g10337 | g10337.t1 | cds | g10337.t1.CDS2 | 8938021 | 8938102 |
| chr_1 | g10337 | g10337.t1 | TSS | g10337.t1 | 8938224 | 8938224 |
>g10337.t1 Gene=g10337 Length=327
ATGCTTTTATTCTGTCCAATCTGCTCCAATCTTTTATTGACGGAATTCTCTTCAACGTGC
TTGCGTTTATCGTGTTCTACTTGTCCTTATATCTCTCGAATTAAGAAAAAGATTTCAGAG
AGAACATATCCTAAACTCAAAGAAGTAGACCATGTTATGGGCGGATCAGAAGCTTGGAAA
AACGTAGATTCAACAGATGCCGTTTGCCCAACTTGCAATCATCCCAAAGCCTATTTCATG
CAAATGCAAATTCGAAGTGCTGATGAACCAATGACAACGTTCTACAGATGCTGTAATCCG
ACCTGTAATCATAATTGGCGGGATTAA
>g10337.t1 Gene=g10337 Length=108
MLLFCPICSNLLLTEFSSTCLRLSCSTCPYISRIKKKISERTYPKLKEVDHVMGGSEAWK
NVDSTDAVCPTCNHPKAYFMQMQIRSADEPMTTFYRCCNPTCNHNWRD
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 13 | g10337.t1 | CDD | cd10509 | Zn-ribbon_RPC11 | 61 | 108 | 7.59384E-28 |
| 6 | g10337.t1 | Gene3D | G3DSA:2.20.25.10 | - | 55 | 108 | 2.8E-23 |
| 2 | g10337.t1 | PANTHER | PTHR11239 | DNA-DIRECTED RNA POLYMERASE | 3 | 107 | 1.8E-37 |
| 3 | g10337.t1 | PANTHER | PTHR11239:SF12 | DNA-DIRECTED RNA POLYMERASE III SUBUNIT RPC10 | 3 | 107 | 1.8E-37 |
| 12 | g10337.t1 | PIRSF | PIRSF005586 | RNApol_RpoM | 2 | 108 | 6.3E-29 |
| 1 | g10337.t1 | Pfam | PF01096 | Transcription factor S-II (TFIIS) | 68 | 107 | 1.5E-19 |
| 8 | g10337.t1 | Phobius | SIGNAL_PEPTIDE | Signal peptide region | 1 | 22 | - |
| 9 | g10337.t1 | Phobius | SIGNAL_PEPTIDE_N_REGION | N-terminal region of a signal peptide. | 1 | 1 | - |
| 10 | g10337.t1 | Phobius | SIGNAL_PEPTIDE_H_REGION | Hydrophobic region of a signal peptide. | 2 | 13 | - |
| 11 | g10337.t1 | Phobius | SIGNAL_PEPTIDE_C_REGION | C-terminal region of a signal peptide. | 14 | 22 | - |
| 7 | g10337.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 23 | 108 | - |
| 16 | g10337.t1 | ProSitePatterns | PS00466 | Zinc finger TFIIS-type signature. | 69 | 106 | - |
| 17 | g10337.t1 | ProSiteProfiles | PS51133 | Zinc finger TFIIS-type profile. | 65 | 107 | 15.358 |
| 15 | g10337.t1 | SMART | SM00661 | rpol9cneu | 3 | 52 | 4.3E-5 |
| 14 | g10337.t1 | SMART | SM00440 | Cys4_2 | 67 | 108 | 4.6E-18 |
| 4 | g10337.t1 | SUPERFAMILY | SSF57783 | Zinc beta-ribbon | 45 | 108 | 6.8E-22 |
| 5 | g10337.t1 | SignalP_EUK | SignalP-noTM | SignalP-noTM | 1 | 16 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0042779 | tRNA 3’-trailer cleavage | BP |
| GO:0008270 | zinc ion binding | MF |
| GO:0006351 | transcription, DNA-templated | BP |
| GO:0003676 | nucleic acid binding | MF |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.