| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10355 | g10355.t1 | TSS | g10355.t1 | 9079453 | 9079453 |
| chr_1 | g10355 | g10355.t1 | isoform | g10355.t1 | 9079965 | 9089750 |
| chr_1 | g10355 | g10355.t1 | exon | g10355.t1.exon1 | 9079965 | 9080010 |
| chr_1 | g10355 | g10355.t1 | cds | g10355.t1.CDS1 | 9079965 | 9080010 |
| chr_1 | g10355 | g10355.t1 | exon | g10355.t1.exon2 | 9085522 | 9085665 |
| chr_1 | g10355 | g10355.t1 | cds | g10355.t1.CDS2 | 9085522 | 9085665 |
| chr_1 | g10355 | g10355.t1 | exon | g10355.t1.exon3 | 9089106 | 9089229 |
| chr_1 | g10355 | g10355.t1 | cds | g10355.t1.CDS3 | 9089106 | 9089229 |
| chr_1 | g10355 | g10355.t1 | exon | g10355.t1.exon4 | 9089428 | 9089576 |
| chr_1 | g10355 | g10355.t1 | cds | g10355.t1.CDS4 | 9089428 | 9089576 |
| chr_1 | g10355 | g10355.t1 | exon | g10355.t1.exon5 | 9089634 | 9089652 |
| chr_1 | g10355 | g10355.t1 | cds | g10355.t1.CDS5 | 9089634 | 9089652 |
| chr_1 | g10355 | g10355.t1 | exon | g10355.t1.exon6 | 9089714 | 9089750 |
| chr_1 | g10355 | g10355.t1 | cds | g10355.t1.CDS6 | 9089714 | 9089750 |
| chr_1 | g10355 | g10355.t1 | TTS | g10355.t1 | 9090432 | 9090432 |
>g10355.t1 Gene=g10355 Length=519
ATGGAAAATATGAGCGAAAACTTCGCAAACATCTCCGAGATTCGAGACTTACGAACGGCT
TTTGACTTGCTTGATCGTGACCAAGATGGCATGGTGACACCCACAGAACTGCAATTTATG
CTCAGAAACTTGGGTATCCATGTGAGCGACGAGTTGATCGATGGTTTAATGAAAGAAGCA
AGTAAAACTGGAAATGGATTGATAGATGAGACAGAATTCCTACAATGGATAGGAAGGATA
CAAGCATTAAGAGAAGAGTCAACTCCATCTGCCGATGACGATGATCTCACACAAGATTTA
GTGGCAGCTTTTAGAGTGTTTGACAGAGACAATAATGGTTATATAACACGTGATGAACTT
CAGCGAGCAATGCAAATGATTGGTGAAAATGTGACTGAAGGACAACTAAATGACATGCTT
GCGCTTGCAGATCTTGACAAAGATGGTAGAATTAATTATGAAGAATTTGCAAGATTGCTA
TTAAATAATGAATTACAATGTTTAAATGTTAAAGAATAA
>g10355.t1 Gene=g10355 Length=172
MENMSENFANISEIRDLRTAFDLLDRDQDGMVTPTELQFMLRNLGIHVSDELIDGLMKEA
SKTGNGLIDETEFLQWIGRIQALREESTPSADDDDLTQDLVAAFRVFDRDNNGYITRDEL
QRAMQMIGENVTEGQLNDMLALADLDKDGRINYEEFARLLLNNELQCLNVKE
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g10355.t1 | CDD | cd00051 | EFh | 99 | 160 | 1.36073E-19 |
| 6 | g10355.t1 | Gene3D | G3DSA:1.10.238.10 | - | 1 | 88 | 1.4E-18 |
| 7 | g10355.t1 | Gene3D | G3DSA:1.10.238.10 | - | 89 | 171 | 1.7E-23 |
| 3 | g10355.t1 | PANTHER | PTHR23050:SF254 | CALCIUM-BINDING PROTEIN E63-1 | 11 | 161 | 2.0E-74 |
| 4 | g10355.t1 | PANTHER | PTHR23050 | CALCIUM BINDING PROTEIN | 11 | 161 | 2.0E-74 |
| 1 | g10355.t1 | Pfam | PF13499 | EF-hand domain pair | 16 | 77 | 7.9E-13 |
| 2 | g10355.t1 | Pfam | PF13499 | EF-hand domain pair | 100 | 159 | 4.7E-15 |
| 11 | g10355.t1 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 25 | 37 | - |
| 9 | g10355.t1 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 108 | 120 | - |
| 10 | g10355.t1 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 144 | 156 | - |
| 17 | g10355.t1 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 12 | 47 | 14.43 |
| 18 | g10355.t1 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 48 | 83 | 8.851 |
| 19 | g10355.t1 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 95 | 130 | 15.518 |
| 16 | g10355.t1 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 131 | 166 | 11.556 |
| 13 | g10355.t1 | SMART | SM00054 | efh_1 | 16 | 44 | 0.0013 |
| 12 | g10355.t1 | SMART | SM00054 | efh_1 | 52 | 80 | 3.4 |
| 15 | g10355.t1 | SMART | SM00054 | efh_1 | 99 | 127 | 1.1E-6 |
| 14 | g10355.t1 | SMART | SM00054 | efh_1 | 135 | 163 | 0.0074 |
| 5 | g10355.t1 | SUPERFAMILY | SSF47473 | EF-hand | 8 | 164 | 9.16E-42 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005509 | calcium ion binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed