| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10355 | g10355.t2 | TSS | g10355.t2 | 9060269 | 9060269 |
| chr_1 | g10355 | g10355.t2 | isoform | g10355.t2 | 9060377 | 9089750 |
| chr_1 | g10355 | g10355.t2 | exon | g10355.t2.exon1 | 9060377 | 9060583 |
| chr_1 | g10355 | g10355.t2 | cds | g10355.t2.CDS1 | 9060377 | 9060583 |
| chr_1 | g10355 | g10355.t2 | exon | g10355.t2.exon2 | 9060681 | 9060950 |
| chr_1 | g10355 | g10355.t2 | cds | g10355.t2.CDS2 | 9060681 | 9060950 |
| chr_1 | g10355 | g10355.t2 | exon | g10355.t2.exon3 | 9062953 | 9062994 |
| chr_1 | g10355 | g10355.t2 | cds | g10355.t2.CDS3 | 9062953 | 9062994 |
| chr_1 | g10355 | g10355.t2 | exon | g10355.t2.exon4 | 9068805 | 9068837 |
| chr_1 | g10355 | g10355.t2 | cds | g10355.t2.CDS4 | 9068805 | 9068837 |
| chr_1 | g10355 | g10355.t2 | exon | g10355.t2.exon5 | 9068931 | 9068976 |
| chr_1 | g10355 | g10355.t2 | cds | g10355.t2.CDS5 | 9068931 | 9068976 |
| chr_1 | g10355 | g10355.t2 | exon | g10355.t2.exon6 | 9085522 | 9085665 |
| chr_1 | g10355 | g10355.t2 | cds | g10355.t2.CDS6 | 9085522 | 9085665 |
| chr_1 | g10355 | g10355.t2 | exon | g10355.t2.exon7 | 9089106 | 9089229 |
| chr_1 | g10355 | g10355.t2 | cds | g10355.t2.CDS7 | 9089106 | 9089229 |
| chr_1 | g10355 | g10355.t2 | exon | g10355.t2.exon8 | 9089428 | 9089576 |
| chr_1 | g10355 | g10355.t2 | cds | g10355.t2.CDS8 | 9089428 | 9089576 |
| chr_1 | g10355 | g10355.t2 | exon | g10355.t2.exon9 | 9089634 | 9089652 |
| chr_1 | g10355 | g10355.t2 | cds | g10355.t2.CDS9 | 9089634 | 9089652 |
| chr_1 | g10355 | g10355.t2 | exon | g10355.t2.exon10 | 9089714 | 9089750 |
| chr_1 | g10355 | g10355.t2 | cds | g10355.t2.CDS10 | 9089714 | 9089750 |
| chr_1 | g10355 | g10355.t2 | TTS | g10355.t2 | 9090432 | 9090432 |
>g10355.t2 Gene=g10355 Length=1071
ATGGGTGATAATAAATTGAATTCAAATGAGACACAATTATTAAAAGCTATGTATGACAAT
ATTACTCATGGATTAGTTGGATTTTTTGCGGCAGCAATTTTATTTACTGATGACTGGGAT
CGAATGTATTGGGCATTAATATGTATGCTACTTTCATCTTTAATTGATGTTGATCATTTT
ATATCAGCATGGTCTTTAAAATTGGCGAATGCAACAAATCTACATTCTCGACCATTTCTT
CACAATTCAACTATACCATTAGTTCTGATTTTTATCCTCATTTTTTGCCACTTATCATAT
CAAGACAACAACATGATAATGACTCTAACTATTCTAATTGTTGCTTTTACGACACATCAT
TTTCGTGATGCATATCGACGAGGGTTAACATTCTTTTTTTATCAAACATCACCATTACCA
TATTATCTCTACATAGGATTAATTTTAATTACACCTTACTTATTAAAGAGTTTTATTACA
ACGAAGCTGGATACCAAAAAAATAGAAGCTGAGATAAAAGTGCTCGGTCAGACAATTATG
GGGAGAAGAAAAAGTTTACAGCAAAAGCCGACAAATTTTTCAGACGATGAGTTAAAAGAC
TTACGAACGGCTTTTGACTTGCTTGATCGTGACCAAGATGGCATGGTGACACCCACAGAA
CTGCAATTTATGCTCAGAAACTTGGGTATCCATGTGAGCGACGAGTTGATCGATGGTTTA
ATGAAAGAAGCAAGTAAAACTGGAAATGGATTGATAGATGAGACAGAATTCCTACAATGG
ATAGGAAGGATACAAGCATTAAGAGAAGAGTCAACTCCATCTGCCGATGACGATGATCTC
ACACAAGATTTAGTGGCAGCTTTTAGAGTGTTTGACAGAGACAATAATGGTTATATAACA
CGTGATGAACTTCAGCGAGCAATGCAAATGATTGGTGAAAATGTGACTGAAGGACAACTA
AATGACATGCTTGCGCTTGCAGATCTTGACAAAGATGGTAGAATTAATTATGAAGAATTT
GCAAGATTGCTATTAAATAATGAATTACAATGTTTAAATGTTAAAGAATAA
>g10355.t2 Gene=g10355 Length=356
MGDNKLNSNETQLLKAMYDNITHGLVGFFAAAILFTDDWDRMYWALICMLLSSLIDVDHF
ISAWSLKLANATNLHSRPFLHNSTIPLVLIFILIFCHLSYQDNNMIMTLTILIVAFTTHH
FRDAYRRGLTFFFYQTSPLPYYLYIGLILITPYLLKSFITTKLDTKKIEAEIKVLGQTIM
GRRKSLQQKPTNFSDDELKDLRTAFDLLDRDQDGMVTPTELQFMLRNLGIHVSDELIDGL
MKEASKTGNGLIDETEFLQWIGRIQALREESTPSADDDDLTQDLVAAFRVFDRDNNGYIT
RDELQRAMQMIGENVTEGQLNDMLALADLDKDGRINYEEFARLLLNNELQCLNVKE
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 19 | g10355.t2 | CDD | cd00051 | EFh | 200 | 261 | 7.3839E-12 |
| 20 | g10355.t2 | CDD | cd00051 | EFh | 283 | 344 | 1.33432E-20 |
| 7 | g10355.t2 | Gene3D | G3DSA:1.10.238.10 | - | 160 | 268 | 1.7E-19 |
| 6 | g10355.t2 | Gene3D | G3DSA:1.10.238.10 | - | 269 | 354 | 4.1E-23 |
| 3 | g10355.t2 | PANTHER | PTHR23050:SF254 | CALCIUM-BINDING PROTEIN E63-1 | 193 | 345 | 1.6E-75 |
| 4 | g10355.t2 | PANTHER | PTHR23050 | CALCIUM BINDING PROTEIN | 193 | 345 | 1.6E-75 |
| 1 | g10355.t2 | Pfam | PF13499 | EF-hand domain pair | 199 | 261 | 2.2E-12 |
| 2 | g10355.t2 | Pfam | PF13499 | EF-hand domain pair | 284 | 343 | 1.8E-14 |
| 12 | g10355.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 19 | - |
| 16 | g10355.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 36 | - |
| 10 | g10355.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 37 | 42 | - |
| 18 | g10355.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 43 | 66 | - |
| 13 | g10355.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 67 | 77 | - |
| 17 | g10355.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 78 | 98 | - |
| 9 | g10355.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 99 | 104 | - |
| 15 | g10355.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 105 | 121 | - |
| 11 | g10355.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 122 | 140 | - |
| 14 | g10355.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 141 | 159 | - |
| 8 | g10355.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 160 | 356 | - |
| 26 | g10355.t2 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 209 | 221 | - |
| 25 | g10355.t2 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 292 | 304 | - |
| 27 | g10355.t2 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 328 | 340 | - |
| 34 | g10355.t2 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 196 | 231 | 14.625 |
| 32 | g10355.t2 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 232 | 267 | 8.851 |
| 35 | g10355.t2 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 279 | 314 | 15.518 |
| 33 | g10355.t2 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 315 | 350 | 11.556 |
| 31 | g10355.t2 | SMART | SM00054 | efh_1 | 200 | 228 | 0.0013 |
| 29 | g10355.t2 | SMART | SM00054 | efh_1 | 236 | 264 | 3.4 |
| 30 | g10355.t2 | SMART | SM00054 | efh_1 | 283 | 311 | 1.1E-6 |
| 28 | g10355.t2 | SMART | SM00054 | efh_1 | 319 | 347 | 0.0074 |
| 5 | g10355.t2 | SUPERFAMILY | SSF47473 | EF-hand | 188 | 349 | 3.98E-43 |
| 23 | g10355.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 35 | - |
| 24 | g10355.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 42 | 64 | - |
| 21 | g10355.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 79 | 101 | - |
| 22 | g10355.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 131 | 153 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005509 | calcium ion binding | MF |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed