| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10355 | g10355.t5 | TSS | g10355.t5 | 9060269 | 9060269 |
| chr_1 | g10355 | g10355.t5 | isoform | g10355.t5 | 9060377 | 9060950 |
| chr_1 | g10355 | g10355.t5 | exon | g10355.t5.exon1 | 9060377 | 9060583 |
| chr_1 | g10355 | g10355.t5 | cds | g10355.t5.CDS1 | 9060377 | 9060583 |
| chr_1 | g10355 | g10355.t5 | exon | g10355.t5.exon2 | 9060681 | 9060950 |
| chr_1 | g10355 | g10355.t5 | cds | g10355.t5.CDS2 | 9060681 | 9060950 |
| chr_1 | g10355 | g10355.t5 | TTS | g10355.t5 | 9061083 | 9061083 |
>g10355.t5 Gene=g10355 Length=477
ATGGGTGATAATAAATTGAATTCAAATGAGACACAATTATTAAAAGCTATGTATGACAAT
ATTACTCATGGATTAGTTGGATTTTTTGCGGCAGCAATTTTATTTACTGATGACTGGGAT
CGAATGTATTGGGCATTAATATGTATGCTACTTTCATCTTTAATTGATGTTGATCATTTT
ATATCAGCATGGTCTTTAAAATTGGCGAATGCAACAAATCTACATTCTCGACCATTTCTT
CACAATTCAACTATACCATTAGTTCTGATTTTTATCCTCATTTTTTGCCACTTATCATAT
CAAGACAACAACATGATAATGACTCTAACTATTCTAATTGTTGCTTTTACGACACATCAT
TTTCGTGATGCATATCGACGAGGGTTAACATTCTTTTTTTATCAAACATCACCATTACCA
TATTATCTCTACATAGGATTAATTTTAATTACACCTTACTTATTAAAGAGTTTTATT
>g10355.t5 Gene=g10355 Length=159
MGDNKLNSNETQLLKAMYDNITHGLVGFFAAAILFTDDWDRMYWALICMLLSSLIDVDHF
ISAWSLKLANATNLHSRPFLHNSTIPLVLIFILIFCHLSYQDNNMIMTLTILIVAFTTHH
FRDAYRRGLTFFFYQTSPLPYYLYIGLILITPYLLKSFI
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 1 | g10355.t5 | PANTHER | PTHR13628 | UNCHARACTERIZED | 9 | 156 | 2.1E-40 |
| 10 | g10355.t5 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 19 | - |
| 14 | g10355.t5 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 36 | - |
| 7 | g10355.t5 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 37 | 42 | - |
| 16 | g10355.t5 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 43 | 66 | - |
| 11 | g10355.t5 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 67 | 77 | - |
| 15 | g10355.t5 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 78 | 98 | - |
| 6 | g10355.t5 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 99 | 104 | - |
| 13 | g10355.t5 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 105 | 121 | - |
| 9 | g10355.t5 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 122 | 140 | - |
| 12 | g10355.t5 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 141 | 158 | - |
| 8 | g10355.t5 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 159 | 159 | - |
| 4 | g10355.t5 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 20 | 35 | - |
| 5 | g10355.t5 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 42 | 64 | - |
| 2 | g10355.t5 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 79 | 101 | - |
| 3 | g10355.t5 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 131 | 153 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.