| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10379 | g10379.t1 | isoform | g10379.t1 | 9329717 | 9330286 |
| chr_1 | g10379 | g10379.t1 | exon | g10379.t1.exon1 | 9329717 | 9329823 |
| chr_1 | g10379 | g10379.t1 | cds | g10379.t1.CDS1 | 9329717 | 9329823 |
| chr_1 | g10379 | g10379.t1 | exon | g10379.t1.exon2 | 9330002 | 9330119 |
| chr_1 | g10379 | g10379.t1 | cds | g10379.t1.CDS2 | 9330002 | 9330119 |
| chr_1 | g10379 | g10379.t1 | exon | g10379.t1.exon3 | 9330188 | 9330286 |
| chr_1 | g10379 | g10379.t1 | cds | g10379.t1.CDS3 | 9330188 | 9330286 |
| chr_1 | g10379 | g10379.t1 | TSS | g10379.t1 | 9330354 | 9330354 |
| chr_1 | g10379 | g10379.t1 | TTS | g10379.t1 | NA | NA |
>g10379.t1 Gene=g10379 Length=324
ATGTCCAACTATGATTGGGATTCACATAATAGACAGGCTATGCTTGAAGGAAGACAGATA
CTTGAAAGAACAACAGCATCATTGGCTAGAAGCAATCAAATTGCTATTGATACAGAAAAT
ACAGGTACAGAAATATTGACAGAGTTAGACAGTCAAAGAGAAGCTCTTTTACGAACAAGT
GAAAGATTGGACAACGCAAATGATGGATTATCTGCAAGTGGCTTTGCCTACGACTTGCCT
TCGATGAAGAAAAATCTTCAAAGACCGAAGATACCTTCAAATAACAACTGGTTCATCACT
GACATGGAAAAGTCGAAAAAATAA
>g10379.t1 Gene=g10379 Length=107
MSNYDWDSHNRQAMLEGRQILERTTASLARSNQIAIDTENTGTEILTELDSQREALLRTS
ERLDNANDGLSASGFAYDLPSMKKNLQRPKIPSNNNWFITDMEKSKK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 5 | g10379.t1 | CDD | cd15890 | SNARE_Vti1b | 18 | 73 | 1.14028E-15 |
| 4 | g10379.t1 | Coils | Coil | Coil | 46 | 66 | - |
| 3 | g10379.t1 | Gene3D | G3DSA:1.20.5.110 | - | 9 | 77 | 8.8E-18 |
| 1 | g10379.t1 | Pfam | PF12352 | Snare region anchored in the vesicle membrane C-terminus | 20 | 73 | 1.6E-11 |
| 2 | g10379.t1 | SUPERFAMILY | SSF58038 | SNARE fusion complex | 8 | 73 | 3.11E-14 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.