General information for g10429.t10
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Ras-related protein Rap1.
Parent gene
- The parent gene g10429 is located on chr_1: 9751244..9752182 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10429 | g10429.t10 | isoform | g10429.t10 | 9751244 | 9751866 |
| chr_1 | g10429 | g10429.t10 | exon | g10429.t10.exon1 | 9751244 | 9751474 |
| chr_1 | g10429 | g10429.t10 | cds | g10429.t10.CDS1 | 9751316 | 9751474 |
| chr_1 | g10429 | g10429.t10 | exon | g10429.t10.exon2 | 9751555 | 9751707 |
| chr_1 | g10429 | g10429.t10 | cds | g10429.t10.CDS2 | 9751555 | 9751707 |
| chr_1 | g10429 | g10429.t10 | exon | g10429.t10.exon3 | 9751777 | 9751866 |
| chr_1 | g10429 | g10429.t10 | cds | g10429.t10.CDS3 | 9751777 | 9751866 |
| chr_1 | g10429 | g10429.t10 | TTS | g10429.t10 | 9752435 | 9752435 |
| chr_1 | g10429 | g10429.t10 | TSS | g10429.t10 | NA | NA |
Sequences
>g10429.t10 Gene=g10429 Length=474
TTTGTCGAGAAATATGATCCGACTATAGAAGACTCTTACCGAAAGCAAGTGGAAGTTGAT
GGACAGCAATGCATGTTGGAAATTCTTGATACGGCTGGAACAGAACAATTTACAGCCATG
CGAGATTTATACATGAAAAATGGACAAGGTTTCATACTTGTATATTCCATCACGGCACAA
TCGATTTTCAATGATTTACAAGATTTACGGGAACAAATTTTGAGAGTTAAGGACACTGAT
GACGTTCCAATGGTTTTGGTTGGCAATAAATGTGATTTGGAGGATGAGAGAGTAGTAGGA
AAAGAGTTAGGAAAGCAACTTGCACAACAATTCAATTGCTCGTTCATGGAAACATCCGCC
AAAGCAAAAATTAACGTTAATGATATATTCAATGATTTAGTTCAGCAAATTAACAAGAAA
TCACCAGAAAAGAAGCAGAGCAAGAAGAAAAAATCATTATGCACTTTGCTATAA
>g10429.t10 Gene=g10429 Length=133
MLEILDTAGTEQFTAMRDLYMKNGQGFILVYSITAQSIFNDLQDLREQILRVKDTDDVPM
VLVGNKCDLEDERVVGKELGKQLAQQFNCSFMETSAKAKINVNDIFNDLVQQINKKSPEK
KQSKKKKSLCTLL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g10429.t10 | Gene3D | G3DSA:3.40.50.300 | - | 1 | 120 | 0.0000 |
| 2 | g10429.t10 | PANTHER | PTHR24070 | RAS, DI-RAS, AND RHEB FAMILY MEMBERS OF SMALL GTPASE SUPERFAMILY | 1 | 133 | 0.0000 |
| 3 | g10429.t10 | PANTHER | PTHR24070:SF424 | RAP1A, MEMBER OF RAS ONCOGENE FAMILY | 1 | 133 | 0.0000 |
| 4 | g10429.t10 | PRINTS | PR00449 | Transforming protein P21 ras signature | 56 | 69 | 0.0000 |
| 5 | g10429.t10 | PRINTS | PR00449 | Transforming protein P21 ras signature | 91 | 113 | 0.0000 |
| 1 | g10429.t10 | Pfam | PF00071 | Ras family | 2 | 114 | 0.0000 |
| 11 | g10429.t10 | ProSiteProfiles | PS51421 | small GTPase Ras family profile. | 1 | 133 | 31.7850 |
| 8 | g10429.t10 | SMART | SM00173 | ras_sub_4 | 1 | 116 | 0.0000 |
| 10 | g10429.t10 | SMART | SM00174 | rho_sub_3 | 1 | 116 | 0.0009 |
| 9 | g10429.t10 | SMART | SM00175 | rab_sub_5 | 2 | 116 | 0.0000 |
| 6 | g10429.t10 | SUPERFAMILY | SSF52540 | P-loop containing nucleoside triphosphate hydrolases | 2 | 125 | 0.0000 |
| 12 | g10429.t10 | TIGRFAM | TIGR00231 | small_GTP: small GTP-binding protein domain | 2 | 107 | 0.0000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016020 | membrane | CC |
| GO:0007165 | signal transduction | BP |
| GO:0005525 | GTP binding | MF |
| GO:0003924 | GTPase activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
