| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10514 | g10514.t6 | isoform | g10514.t6 | 10311027 | 10311614 |
| chr_1 | g10514 | g10514.t6 | exon | g10514.t6.exon1 | 10311027 | 10311483 |
| chr_1 | g10514 | g10514.t6 | cds | g10514.t6.CDS1 | 10311106 | 10311450 |
| chr_1 | g10514 | g10514.t6 | exon | g10514.t6.exon2 | 10311585 | 10311614 |
| chr_1 | g10514 | g10514.t6 | TSS | g10514.t6 | NA | NA |
| chr_1 | g10514 | g10514.t6 | TTS | g10514.t6 | NA | NA |
>g10514.t6 Gene=g10514 Length=487
AGTTTTACATTTAAATGTTTGCTGATTATATTTGAAATAGAATTATCCATAATAAAAAAT
ATGAAAAATAAAAATATACATGTATGTAGTGTTTTCAATTTTGTACATCGAAAAATTAAA
GCTTATTAATAAGAAAAATCATTCTGATGAGGAACTTGAGCTTGATGATGAGCTACTGCT
GCTAGATGATGAGTCACTTTCGGAATCACTCGAGTCAGAGCTAGAACTCGAAGAATCACT
TTCAGAATCACTGCTACTACTTGAGCTTGATGATGGACTTTTCTTCCTTTTCTTAATTGG
CGGTTCATCTAAATTTCTTCCTGACTCTTGTTGTTTTTCTCGATTTTCCAAATTCTTTTT
TAACATCTTTGTTCGACTGTCTCTGATTAATGTTTTGTGTTTATTCTTACACTCATATGT
ATAATGACCAAATTCTAAGCATTTCTGACAACGCACTCTTTTGAGGCTTCTTTTTCGGTA
CAATCAT
>g10514.t6 Gene=g10514 Length=114
MYVVFSILYIEKLKLINKKNHSDEELELDDELLLLDDESLSESLESELELEESLSESLLL
LELDDGLFFLFLIGGSSKFLPDSCCFSRFSKFFFNIFVRLSLINVLCLFLHSYV
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 3 | g10514.t6 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 57 | - |
| 5 | g10514.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 58 | 80 | - |
| 1 | g10514.t6 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 81 | 91 | - |
| 4 | g10514.t6 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 92 | 113 | - |
| 2 | g10514.t6 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 114 | 114 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.