| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10587 | g10587.t1 | TSS | g10587.t1 | 10545802 | 10545802 |
| chr_1 | g10587 | g10587.t1 | isoform | g10587.t1 | 10545894 | 10546560 |
| chr_1 | g10587 | g10587.t1 | exon | g10587.t1.exon1 | 10545894 | 10545939 |
| chr_1 | g10587 | g10587.t1 | cds | g10587.t1.CDS1 | 10545894 | 10545939 |
| chr_1 | g10587 | g10587.t1 | exon | g10587.t1.exon2 | 10546043 | 10546560 |
| chr_1 | g10587 | g10587.t1 | cds | g10587.t1.CDS2 | 10546043 | 10546560 |
| chr_1 | g10587 | g10587.t1 | TTS | g10587.t1 | 10546716 | 10546716 |
>g10587.t1 Gene=g10587 Length=564
ATGTCTATCATTCGTTCATTATTTGATGATCCATTCTTTTCTAATGAAATGGAACCACGA
TTCGGATTAGGCTTGATTCCTAGTGATTTCTTTTCTGATCGCATTGTTCCACGCTCTAGT
TACTTGCCAACTGGTTATCGTCGCCCGTGGCAAATTGCTCGTGAAGCTATCAATGAGTTG
AGCAAAGATCAGAAATCTATGCACCTTGGCAAAGATGGCTTTCAAGCTTGCGTCGATGTT
CATCATTTCAATCCAAATGAAATCACAGTAAAGACAGTTGATCAAACAGTTATTATTGAA
GGAAAGCATGAAGAACGTGATGATGCACATGGCACAATTGAACGTCACTTTATTCGCAAA
TATGTCTTGCCAAAGGAGTATGATATGAATACAGTTCAATCTACTTTATCCAGTGATGGT
GTTCTTACAATCAAGGCTCCACCACCAGCTATCGAAGGATCTAATGAACGTCATATTCCT
ATCACTCATACAAACGCTCCAGCTCATTTGGGCATTAAAGAGAACAAACCACAATCTGAA
GAGTCTAATGGAAAGGCTCAATAA
>g10587.t1 Gene=g10587 Length=187
MSIIRSLFDDPFFSNEMEPRFGLGLIPSDFFSDRIVPRSSYLPTGYRRPWQIAREAINEL
SKDQKSMHLGKDGFQACVDVHHFNPNEITVKTVDQTVIIEGKHEERDDAHGTIERHFIRK
YVLPKEYDMNTVQSTLSSDGVLTIKAPPPAIEGSNERHIPITHTNAPAHLGIKENKPQSE
ESNGKAQ
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 11 | g10587.t1 | CDD | cd06526 | metazoan_ACD | 70 | 147 | 9.31674E-40 |
| 10 | g10587.t1 | Gene3D | G3DSA:2.60.40.790 | - | 47 | 183 | 1.1E-29 |
| 12 | g10587.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 165 | 187 | - |
| 2 | g10587.t1 | PANTHER | PTHR45640:SF23 | HEAT SHOCK PROTEIN 22-RELATED | 54 | 177 | 3.5E-47 |
| 3 | g10587.t1 | PANTHER | PTHR45640 | HEAT SHOCK PROTEIN HSP-12.2-RELATED | 54 | 177 | 3.5E-47 |
| 7 | g10587.t1 | PRINTS | PR00299 | Alpha crystallin signature | 68 | 88 | 1.5E-20 |
| 4 | g10587.t1 | PRINTS | PR00299 | Alpha crystallin signature | 90 | 103 | 1.5E-20 |
| 8 | g10587.t1 | PRINTS | PR00299 | Alpha crystallin signature | 105 | 124 | 1.5E-20 |
| 6 | g10587.t1 | PRINTS | PR00299 | Alpha crystallin signature | 127 | 148 | 1.5E-20 |
| 5 | g10587.t1 | PRINTS | PR00299 | Alpha crystallin signature | 156 | 171 | 1.5E-20 |
| 1 | g10587.t1 | Pfam | PF00011 | Hsp20/alpha crystallin family | 70 | 161 | 1.7E-24 |
| 13 | g10587.t1 | ProSiteProfiles | PS01031 | Small heat shock protein (sHSP) domain profile. | 55 | 164 | 18.994 |
| 9 | g10587.t1 | SUPERFAMILY | SSF49764 | HSP20-like chaperones | 69 | 161 | 3.77E-14 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.