Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Heat shock protein 23.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g10587 g10587.t7 TSS g10587.t7 10545802 10545802
chr_1 g10587 g10587.t7 isoform g10587.t7 10545894 10546560
chr_1 g10587 g10587.t7 exon g10587.t7.exon1 10545894 10545939
chr_1 g10587 g10587.t7 exon g10587.t7.exon2 10546116 10546560
chr_1 g10587 g10587.t7 cds g10587.t7.CDS1 10546195 10546560
chr_1 g10587 g10587.t7 TTS g10587.t7 10546716 10546716

Sequences

>g10587.t7 Gene=g10587 Length=491
ATGTCTATCATTCGTTCATTATTTGATGATCCATTCTTTTCTAATGTTACTTGCCAACTG
GTTATCGTCGCCCGTGGCAAATTGCTCGTGAAGCTATCAATGAGTTGAGCAAAGATCAGA
AATCTATGCACCTTGGCAAAGATGGCTTTCAAGCTTGCGTCGATGTTCATCATTTCAATC
CAAATGAAATCACAGTAAAGACAGTTGATCAAACAGTTATTATTGAAGGAAAGCATGAAG
AACGTGATGATGCACATGGCACAATTGAACGTCACTTTATTCGCAAATATGTCTTGCCAA
AGGAGTATGATATGAATACAGTTCAATCTACTTTATCCAGTGATGGTGTTCTTACAATCA
AGGCTCCACCACCAGCTATCGAAGGATCTAATGAACGTCATATTCCTATCACTCATACAA
ACGCTCCAGCTCATTTGGGCATTAAAGAGAACAAACCACAATCTGAAGAGTCTAATGGAA
AGGCTCAATAA

>g10587.t7 Gene=g10587 Length=121
MHLGKDGFQACVDVHHFNPNEITVKTVDQTVIIEGKHEERDDAHGTIERHFIRKYVLPKE
YDMNTVQSTLSSDGVLTIKAPPPAIEGSNERHIPITHTNAPAHLGIKENKPQSEESNGKA
Q

Protein features from InterProScan

Transcript Database ID Name Start End E.value
11 g10587.t7 CDD cd06526 metazoan_ACD 4 81 2.66484E-39
10 g10587.t7 Gene3D G3DSA:2.60.40.790 - 2 118 1.1E-29
12 g10587.t7 MobiDBLite mobidb-lite consensus disorder prediction 99 121 -
2 g10587.t7 PANTHER PTHR45640:SF23 HEAT SHOCK PROTEIN 22-RELATED 2 111 5.3E-46
3 g10587.t7 PANTHER PTHR45640 HEAT SHOCK PROTEIN HSP-12.2-RELATED 2 111 5.3E-46
7 g10587.t7 PRINTS PR00299 Alpha crystallin signature 2 22 3.4E-21
6 g10587.t7 PRINTS PR00299 Alpha crystallin signature 24 37 3.4E-21
8 g10587.t7 PRINTS PR00299 Alpha crystallin signature 39 58 3.4E-21
5 g10587.t7 PRINTS PR00299 Alpha crystallin signature 61 82 3.4E-21
4 g10587.t7 PRINTS PR00299 Alpha crystallin signature 90 105 3.4E-21
1 g10587.t7 Pfam PF00011 Hsp20/alpha crystallin family 4 95 5.5E-25
13 g10587.t7 ProSiteProfiles PS01031 Small heat shock protein (sHSP) domain profile. 1 98 20.24
9 g10587.t7 SUPERFAMILY SSF49764 HSP20-like chaperones 4 95 1.67E-14

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

Pathway

  • This transcript belongs to the following pathways

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed