| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10587 | g10587.t7 | TSS | g10587.t7 | 10545802 | 10545802 |
| chr_1 | g10587 | g10587.t7 | isoform | g10587.t7 | 10545894 | 10546560 |
| chr_1 | g10587 | g10587.t7 | exon | g10587.t7.exon1 | 10545894 | 10545939 |
| chr_1 | g10587 | g10587.t7 | exon | g10587.t7.exon2 | 10546116 | 10546560 |
| chr_1 | g10587 | g10587.t7 | cds | g10587.t7.CDS1 | 10546195 | 10546560 |
| chr_1 | g10587 | g10587.t7 | TTS | g10587.t7 | 10546716 | 10546716 |
>g10587.t7 Gene=g10587 Length=491
ATGTCTATCATTCGTTCATTATTTGATGATCCATTCTTTTCTAATGTTACTTGCCAACTG
GTTATCGTCGCCCGTGGCAAATTGCTCGTGAAGCTATCAATGAGTTGAGCAAAGATCAGA
AATCTATGCACCTTGGCAAAGATGGCTTTCAAGCTTGCGTCGATGTTCATCATTTCAATC
CAAATGAAATCACAGTAAAGACAGTTGATCAAACAGTTATTATTGAAGGAAAGCATGAAG
AACGTGATGATGCACATGGCACAATTGAACGTCACTTTATTCGCAAATATGTCTTGCCAA
AGGAGTATGATATGAATACAGTTCAATCTACTTTATCCAGTGATGGTGTTCTTACAATCA
AGGCTCCACCACCAGCTATCGAAGGATCTAATGAACGTCATATTCCTATCACTCATACAA
ACGCTCCAGCTCATTTGGGCATTAAAGAGAACAAACCACAATCTGAAGAGTCTAATGGAA
AGGCTCAATAA
>g10587.t7 Gene=g10587 Length=121
MHLGKDGFQACVDVHHFNPNEITVKTVDQTVIIEGKHEERDDAHGTIERHFIRKYVLPKE
YDMNTVQSTLSSDGVLTIKAPPPAIEGSNERHIPITHTNAPAHLGIKENKPQSEESNGKA
Q
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 11 | g10587.t7 | CDD | cd06526 | metazoan_ACD | 4 | 81 | 2.66484E-39 |
| 10 | g10587.t7 | Gene3D | G3DSA:2.60.40.790 | - | 2 | 118 | 1.1E-29 |
| 12 | g10587.t7 | MobiDBLite | mobidb-lite | consensus disorder prediction | 99 | 121 | - |
| 2 | g10587.t7 | PANTHER | PTHR45640:SF23 | HEAT SHOCK PROTEIN 22-RELATED | 2 | 111 | 5.3E-46 |
| 3 | g10587.t7 | PANTHER | PTHR45640 | HEAT SHOCK PROTEIN HSP-12.2-RELATED | 2 | 111 | 5.3E-46 |
| 7 | g10587.t7 | PRINTS | PR00299 | Alpha crystallin signature | 2 | 22 | 3.4E-21 |
| 6 | g10587.t7 | PRINTS | PR00299 | Alpha crystallin signature | 24 | 37 | 3.4E-21 |
| 8 | g10587.t7 | PRINTS | PR00299 | Alpha crystallin signature | 39 | 58 | 3.4E-21 |
| 5 | g10587.t7 | PRINTS | PR00299 | Alpha crystallin signature | 61 | 82 | 3.4E-21 |
| 4 | g10587.t7 | PRINTS | PR00299 | Alpha crystallin signature | 90 | 105 | 3.4E-21 |
| 1 | g10587.t7 | Pfam | PF00011 | Hsp20/alpha crystallin family | 4 | 95 | 5.5E-25 |
| 13 | g10587.t7 | ProSiteProfiles | PS01031 | Small heat shock protein (sHSP) domain profile. | 1 | 98 | 20.24 |
| 9 | g10587.t7 | SUPERFAMILY | SSF49764 | HSP20-like chaperones | 4 | 95 | 1.67E-14 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed