| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10617 | g10617.t1 | TSS | g10617.t1 | 10774169 | 10774169 |
| chr_1 | g10617 | g10617.t1 | isoform | g10617.t1 | 10774663 | 10775827 |
| chr_1 | g10617 | g10617.t1 | exon | g10617.t1.exon1 | 10774663 | 10774731 |
| chr_1 | g10617 | g10617.t1 | cds | g10617.t1.CDS1 | 10774663 | 10774731 |
| chr_1 | g10617 | g10617.t1 | exon | g10617.t1.exon2 | 10775645 | 10775827 |
| chr_1 | g10617 | g10617.t1 | cds | g10617.t1.CDS2 | 10775645 | 10775827 |
| chr_1 | g10617 | g10617.t1 | TTS | g10617.t1 | 10776588 | 10776588 |
>g10617.t1 Gene=g10617 Length=252
ATGGGATTTCCTCGAGTTTTTTTCGATATGGCCGCTGATGGTCAAGCACTTGGAAGAATT
GTAATTGAACTTCGTACTGATGTCGTCCCAAAAACATGCGAAAACTTCCGTGCGTTGTGC
ACCGGCGAAAAGGGATATGGATATAAAGGTTCAACATTCCACCTGTTCATTCCCAATTTC
ATGTGTCAAGGCGGTGACTTTACAAAATCACAATGGAACTGGAGGAAAATCAATCTATGG
CAACAAGTTTGA
>g10617.t1 Gene=g10617 Length=83
MGFPRVFFDMAADGQALGRIVIELRTDVVPKTCENFRALCTGEKGYGYKGSTFHLFIPNF
MCQGGDFTKSQWNWRKINLWQQV
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g10617.t1 | Gene3D | G3DSA:2.40.100.10 | - | 1 | 78 | 0.000 |
| 2 | g10617.t1 | PANTHER | PTHR11071 | PEPTIDYL-PROLYL CIS-TRANS ISOMERASE | 4 | 69 | 0.000 |
| 3 | g10617.t1 | PANTHER | PTHR11071:SF408 | PEPTIDYL-PROLYL CIS-TRANS ISOMERASE F, MITOCHONDRIAL | 4 | 69 | 0.000 |
| 5 | g10617.t1 | PRINTS | PR00153 | Cyclophilin peptidyl-prolyl cis-trans isomerase signature | 24 | 39 | 0.000 |
| 4 | g10617.t1 | PRINTS | PR00153 | Cyclophilin peptidyl-prolyl cis-trans isomerase signature | 53 | 65 | 0.000 |
| 1 | g10617.t1 | Pfam | PF00160 | Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD | 8 | 71 | 0.000 |
| 8 | g10617.t1 | ProSiteProfiles | PS50072 | Cyclophilin-type peptidyl-prolyl cis-trans isomerase domain profile. | 7 | 83 | 17.552 |
| 6 | g10617.t1 | SUPERFAMILY | SSF50891 | Cyclophilin-like | 3 | 70 | 0.000 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003755 | peptidyl-prolyl cis-trans isomerase activity | MF |
| GO:0000413 | protein peptidyl-prolyl isomerization | BP |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed