| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10618 | g10618.t1 | isoform | g10618.t1 | 10777231 | 10777920 |
| chr_1 | g10618 | g10618.t1 | exon | g10618.t1.exon1 | 10777231 | 10777285 |
| chr_1 | g10618 | g10618.t1 | cds | g10618.t1.CDS1 | 10777231 | 10777285 |
| chr_1 | g10618 | g10618.t1 | exon | g10618.t1.exon2 | 10777742 | 10777920 |
| chr_1 | g10618 | g10618.t1 | cds | g10618.t1.CDS2 | 10777742 | 10777920 |
| chr_1 | g10618 | g10618.t1 | TSS | g10618.t1 | NA | NA |
| chr_1 | g10618 | g10618.t1 | TTS | g10618.t1 | NA | NA |
>g10618.t1 Gene=g10618 Length=234
ATGAAGGATAGATCAATTTCAGAGCCTCCACAATCACGATATAAACAATCATACTACAAC
GTTGGAGGAGCTTCTGCTTATCCACGAAAAGTTATCAAATCAACACAAGATACTCAGAAA
TCCGATACAAATGAGACCATCATCAAGCTATCAAATTCGTCAAACACATCTACAAAATCT
GAAGGAGCTGCTGGATATAATATGCCTGAATCAAAGCAGCAAAGCGAATTTTAG
>g10618.t1 Gene=g10618 Length=77
MKDRSISEPPQSRYKQSYYNVGGASAYPRKVIKSTQDTQKSDTNETIIKLSNSSNTSTKS
EGAAGYNMPESKQQSEF
| Transcript | Database | ID | Name | Start | End | E.value |
|---|---|---|---|---|---|---|
| g10618.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 33 | 77 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed