General information for g10641.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Acyl-CoA Delta(11) desaturase.
Parent gene
- The parent gene g10641 is located on chr_1: 11021933..11024872 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10641 | g10641.t1 | isoform | g10641.t1 | 11021933 | 11024872 |
| chr_1 | g10641 | g10641.t1 | exon | g10641.t1.exon1 | 11021933 | 11021982 |
| chr_1 | g10641 | g10641.t1 | cds | g10641.t1.CDS1 | 11021933 | 11021982 |
| chr_1 | g10641 | g10641.t1 | exon | g10641.t1.exon2 | 11022064 | 11022327 |
| chr_1 | g10641 | g10641.t1 | cds | g10641.t1.CDS2 | 11022064 | 11022327 |
| chr_1 | g10641 | g10641.t1 | exon | g10641.t1.exon3 | 11022449 | 11022681 |
| chr_1 | g10641 | g10641.t1 | cds | g10641.t1.CDS3 | 11022449 | 11022681 |
| chr_1 | g10641 | g10641.t1 | exon | g10641.t1.exon4 | 11022735 | 11023227 |
| chr_1 | g10641 | g10641.t1 | cds | g10641.t1.CDS4 | 11022735 | 11023227 |
| chr_1 | g10641 | g10641.t1 | exon | g10641.t1.exon5 | 11024797 | 11024872 |
| chr_1 | g10641 | g10641.t1 | cds | g10641.t1.CDS5 | 11024797 | 11024872 |
| chr_1 | g10641 | g10641.t1 | TSS | g10641.t1 | NA | NA |
| chr_1 | g10641 | g10641.t1 | TTS | g10641.t1 | NA | NA |
Sequences
>g10641.t1 Gene=g10641 Length=1116
ATGGGAAGAAACTTTAGTGAAGATTCAGTTTTAACTAAACAAAGAAATGGAGTTAAAGAA
AAAAATACAAATGAAGACTCGATAACAGAGACGAATGATGTGGTGGAGAAATCAACGACT
GAATATAAAATGGAAATTAAGTGGATAAATGTACTCGTTGCAATTTATTTGCATGGTTGC
GCCTTCTATAGTATATTTTTGCCAATGAAATATTGGAAAACAGTGGCAATTGGATGGATT
TACTCTATTATATCGGGCTTTGGCACAACTGTTGCTGCACATCGCTACTTTACACATCGA
ACATTCAAGGCTAATAAACCACTAAAGATTCTTTTAATTATTTTCCAAACAATGGCAGCT
CAAGAACCGATTCTTCATTGGGCTCGTGATCATCGTGTTCATCATAAATTTACAGACACT
GATGCTGATCCATATAATTCAAGGAGAGGTTTCTTTTTCTCACATATGGGCTGGTTGCTT
GTTAAAAAACATCCTGAAGTTATCAGACAAGGAAAGAAAATTGATATGAGTGATCTTCGT
GATGATCCAATGTTAAAATTCCAAAAAAGATGGTATGCAATTTTGGGATTTTTAGGAAAT
ATTGGTGTTCCAATTTTATTAGGACTTTGGTGTGGTGAAGATTTTAAGACACTTTGGTAT
GGTAATATTTATCGTTACTTGATTGTCTTGCATTGTGTTTGGTGTGTCAATTCTGTTGCT
CATATTTGGGGCACAAAGCCTTATGACAAAGATATATCACCGACTGATTCAAGATTTGTT
GGATTTGTTGCTATTGGAGAAGGCTGGCATAATTATCACCACGTGTTTCCTTGGGATTAC
AAAACCGCAGAACTTCCTGGTTACCGTTGGAACTTGTCAACGTCTGTCATTGATTTCTTT
GCATGGCTAGGCTGGGCTACAGAATTGAAAACTGTTCCTGATGAAATTATTAGAAAACGA
GTTTTAAGAACGGGTGATGGCAGTCATCCATATTCAATTGAGATGCAAAATAACAACAAC
AATAATTTTGACAAGTTAAGGGATACTGAGCATTTTTGGGGTTTTGGTGATCAAGAAATG
ACTACAGAAGATATGAAATACGTAAAAGTTTTATGA
>g10641.t1 Gene=g10641 Length=371
MGRNFSEDSVLTKQRNGVKEKNTNEDSITETNDVVEKSTTEYKMEIKWINVLVAIYLHGC
AFYSIFLPMKYWKTVAIGWIYSIISGFGTTVAAHRYFTHRTFKANKPLKILLIIFQTMAA
QEPILHWARDHRVHHKFTDTDADPYNSRRGFFFSHMGWLLVKKHPEVIRQGKKIDMSDLR
DDPMLKFQKRWYAILGFLGNIGVPILLGLWCGEDFKTLWYGNIYRYLIVLHCVWCVNSVA
HIWGTKPYDKDISPTDSRFVGFVAIGEGWHNYHHVFPWDYKTAELPGYRWNLSTSVIDFF
AWLGWATELKTVPDEIIRKRVLRTGDGSHPYSIEMQNNNNNNFDKLRDTEHFWGFGDQEM
TTEDMKYVKVL
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 25 | g10641.t1 | CDD | cd03505 | Delta9-FADS-like | 71 | 310 | 5.09683E-74 |
| 15 | g10641.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 30 | - |
| 14 | g10641.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 13 | 30 | - |
| 2 | g10641.t1 | PANTHER | PTHR11351 | ACYL-COA DESATURASE | 17 | 337 | 2.6E-114 |
| 3 | g10641.t1 | PANTHER | PTHR11351:SF31 | RE43130P | 17 | 337 | 2.6E-114 |
| 9 | g10641.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 48 | 68 | 1.9E-47 |
| 7 | g10641.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 71 | 93 | 1.9E-47 |
| 4 | g10641.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 94 | 114 | 1.9E-47 |
| 8 | g10641.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 131 | 160 | 1.9E-47 |
| 5 | g10641.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 223 | 244 | 1.9E-47 |
| 6 | g10641.t1 | PRINTS | PR00075 | Fatty acid desaturase family 1 signature | 266 | 280 | 1.9E-47 |
| 1 | g10641.t1 | Pfam | PF00487 | Fatty acid desaturase | 74 | 279 | 6.4E-18 |
| 16 | g10641.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 47 | - |
| 21 | g10641.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 48 | 66 | - |
| 20 | g10641.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 67 | 77 | - |
| 23 | g10641.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 78 | 97 | - |
| 18 | g10641.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 98 | 190 | - |
| 22 | g10641.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 191 | 211 | - |
| 19 | g10641.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 212 | 222 | - |
| 24 | g10641.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 223 | 243 | - |
| 17 | g10641.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 244 | 371 | - |
| 13 | g10641.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 48 | 65 | - |
| 10 | g10641.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 75 | 97 | - |
| 12 | g10641.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 191 | 213 | - |
| 11 | g10641.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 223 | 245 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0055114 | NA | NA |
| GO:0016717 | oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water | MF |
| GO:0006629 | lipid metabolic process | BP |
KEGG
Orthology
- This transcript has been annotated with K23119 (very-long-chain acyl-lipid omega-9 desaturase)
Pathway
This gene does not belong to any pathways.
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed