General information for g10678.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Ethanolaminephosphotransferase 1.
Parent gene
- The parent gene g10678 is located on chr_1: 11285578..11286906 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10678 | g10678.t1 | TSS | g10678.t1 | 11284859 | 11284859 |
| chr_1 | g10678 | g10678.t1 | isoform | g10678.t1 | 11284970 | 11286543 |
| chr_1 | g10678 | g10678.t1 | exon | g10678.t1.exon1 | 11284970 | 11285017 |
| chr_1 | g10678 | g10678.t1 | cds | g10678.t1.CDS1 | 11284970 | 11285017 |
| chr_1 | g10678 | g10678.t1 | exon | g10678.t1.exon2 | 11285130 | 11285198 |
| chr_1 | g10678 | g10678.t1 | cds | g10678.t1.CDS2 | 11285130 | 11285198 |
| chr_1 | g10678 | g10678.t1 | exon | g10678.t1.exon3 | 11285281 | 11285470 |
| chr_1 | g10678 | g10678.t1 | cds | g10678.t1.CDS3 | 11285281 | 11285470 |
| chr_1 | g10678 | g10678.t1 | exon | g10678.t1.exon4 | 11285554 | 11285773 |
| chr_1 | g10678 | g10678.t1 | cds | g10678.t1.CDS4 | 11285554 | 11285773 |
| chr_1 | g10678 | g10678.t1 | exon | g10678.t1.exon5 | 11285836 | 11285873 |
| chr_1 | g10678 | g10678.t1 | cds | g10678.t1.CDS5 | 11285836 | 11285873 |
| chr_1 | g10678 | g10678.t1 | exon | g10678.t1.exon6 | 11285942 | 11286543 |
| chr_1 | g10678 | g10678.t1 | cds | g10678.t1.CDS6 | 11285942 | 11286543 |
| chr_1 | g10678 | g10678.t1 | TTS | g10678.t1 | 11286967 | 11286967 |
Sequences
>g10678.t1 Gene=g10678 Length=1167
ATGGGCTATTTGACAAAAGAAATTCTAGATGGTTTTGACAAGTATAAGTACTCTGCACGA
GACACAAATCCGTTGTCAGTTTATGTTATGTCGCCGTTTTGGGACACAGTAGTGCAGTAC
TTTCCCAAATGGATAGCGCCAAATTTGATGACGTTTCTTGGATTTTTACTAACAGCTCTA
AATTTTGTGATGCTTTCATATTATGATTGGAATTTTTATGCTGAGACCGATAATGAGAGT
TCTCCGTCTATTCCACGATGGTTCTGGCTTTTTGCTGCTGTCAACATTTTTCTTGCATAT
ACGTTAGATGGCATTGACGGAAAGCAAGCACGACGAATAAATTTGAGTGGACCTCTTGGA
GAATTATTTGATCACGGTTTAGATTCATATTCAGCTTCATTGATTCCTGTCTGTTTATAT
AGTGTCTTTGGAAGAGGCGCGCAATATTCAGTTGAACCTATGAGATTTTATTACGTAGTT
CTTATGATACTCGTTAATTTTCATATATCACATTGGGAAAAGTACAACACTGGAGTTCTC
TTTCTTCCATGGGGCTATGATTTTGCAATGTGGGGAAGCACACTCATGTATTTGGCAACA
TATTTTTTTGGATCAGGCATCTATCATATTCCTTTAACACCAAATGGTCTTACGTGTGGC
CATTTTCTAGAATATGTTTTACATATCAGCGCGTTATCAAACATTCCAATGGTTTTTTAT
AACCTTTATAGATCATACGCTGATAAAACAGGCAAAATGCGTACATTTACGGAGTGTGTG
AGACCATTAGTTCCCTTAGCAATTTTTATTGCTATTTCTCTTCTTTGGGCACATTATTCT
CCAAATAACATCGTTTACAACGATCCACGTGCAGTTTATCTTCTTACTGGCACAATTTTT
AGCAACATCAGTTGTCGATTGATTGTTGCACAAATGAGTAACACTAGATGCGAGGCTATG
AATTGGACAACGCCATATTTAATATTAGCTTTTCTTGGTTCAATTTTAATGCCGAGACTC
GAAAGAATTTTTCTTTATGGAATGCTAATTCTTTCAACTTTAACACATTGGCATTATGGA
ACTGTCGTAGTACAACAAATGTGTGAGCACTTTAACCGTATTTGTTTTGGAGTCACACTT
AGAACAAAAAAGAATGATGTTGATTAA
>g10678.t1 Gene=g10678 Length=388
MGYLTKEILDGFDKYKYSARDTNPLSVYVMSPFWDTVVQYFPKWIAPNLMTFLGFLLTAL
NFVMLSYYDWNFYAETDNESSPSIPRWFWLFAAVNIFLAYTLDGIDGKQARRINLSGPLG
ELFDHGLDSYSASLIPVCLYSVFGRGAQYSVEPMRFYYVVLMILVNFHISHWEKYNTGVL
FLPWGYDFAMWGSTLMYLATYFFGSGIYHIPLTPNGLTCGHFLEYVLHISALSNIPMVFY
NLYRSYADKTGKMRTFTECVRPLVPLAIFIAISLLWAHYSPNNIVYNDPRAVYLLTGTIF
SNISCRLIVAQMSNTRCEAMNWTTPYLILAFLGSILMPRLERIFLYGMLILSTLTHWHYG
TVVVQQMCEHFNRICFGVTLRTKKNDVD
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 13 | g10678.t1 | Gene3D | G3DSA:1.20.120.1760 | - | 22 | 204 | 3.2E-13 |
| 2 | g10678.t1 | PANTHER | PTHR10414:SF71 | FI05338P | 2 | 383 | 1.6E-158 |
| 3 | g10678.t1 | PANTHER | PTHR10414 | ETHANOLAMINEPHOSPHOTRANSFERASE | 2 | 383 | 1.6E-158 |
| 35 | g10678.t1 | PIRSF | PIRSF015665 | CHOPT | 1 | 388 | 2.6E-118 |
| 1 | g10678.t1 | Pfam | PF01066 | CDP-alcohol phosphatidyltransferase | 46 | 128 | 3.3E-14 |
| 15 | g10678.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 48 | - |
| 33 | g10678.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 49 | 67 | - |
| 21 | g10678.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 68 | 86 | - |
| 28 | g10678.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 87 | 105 | - |
| 14 | g10678.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 106 | 125 | - |
| 27 | g10678.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 126 | 143 | - |
| 23 | g10678.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 144 | 154 | - |
| 34 | g10678.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 155 | 172 | - |
| 17 | g10678.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 173 | 183 | - |
| 29 | g10678.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 184 | 210 | - |
| 20 | g10678.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 211 | 221 | - |
| 32 | g10678.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 222 | 243 | - |
| 19 | g10678.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 244 | 262 | - |
| 26 | g10678.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 263 | 279 | - |
| 22 | g10678.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 280 | 290 | - |
| 25 | g10678.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 291 | 309 | - |
| 16 | g10678.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 310 | 320 | - |
| 31 | g10678.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 321 | 337 | - |
| 24 | g10678.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 338 | 342 | - |
| 30 | g10678.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 343 | 364 | - |
| 18 | g10678.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 365 | 388 | - |
| 12 | g10678.t1 | ProSitePatterns | PS00379 | CDP-alcohol phosphatidyltransferases signature. | 106 | 128 | - |
| 6 | g10678.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 46 | 68 | - |
| 8 | g10678.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 83 | 102 | - |
| 4 | g10678.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 188 | 210 | - |
| 7 | g10678.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 225 | 247 | - |
| 9 | g10678.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 259 | 281 | - |
| 5 | g10678.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 291 | 310 | - |
| 11 | g10678.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 319 | 338 | - |
| 10 | g10678.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 342 | 364 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0016020 | membrane | CC |
| GO:0008654 | phospholipid biosynthetic process | BP |
| GO:0016780 | phosphotransferase activity, for other substituted phosphate groups | MF |
KEGG
Orthology
- This transcript has been annotated with K00993 (ethanolaminephosphotransferase)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
