Gene loci information

Transcript annotation

  • This transcript has been annotated as 14-3-3 protein zeta.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g10748 g10748.t83 TSS g10748.t83 11691231 11691231
chr_1 g10748 g10748.t83 isoform g10748.t83 11691452 11692644
chr_1 g10748 g10748.t83 exon g10748.t83.exon1 11691452 11691513
chr_1 g10748 g10748.t83 cds g10748.t83.CDS1 11691452 11691513
chr_1 g10748 g10748.t83 exon g10748.t83.exon2 11691725 11691838
chr_1 g10748 g10748.t83 cds g10748.t83.CDS2 11691725 11691838
chr_1 g10748 g10748.t83 exon g10748.t83.exon3 11691899 11692025
chr_1 g10748 g10748.t83 cds g10748.t83.CDS3 11691899 11692025
chr_1 g10748 g10748.t83 exon g10748.t83.exon4 11692186 11692309
chr_1 g10748 g10748.t83 cds g10748.t83.CDS4 11692186 11692309
chr_1 g10748 g10748.t83 exon g10748.t83.exon5 11692597 11692644
chr_1 g10748 g10748.t83 cds g10748.t83.CDS5 11692597 11692643
chr_1 g10748 g10748.t83 TTS g10748.t83 NA NA

Sequences

>g10748.t83 Gene=g10748 Length=475
ATGTCAACCGTTGATAAAGAAGAACTTGTCCAGAAAGCAAAACTTGCTGAACAGTCTGAA
AGATATGATGATATGGCACAAGCCATGAAATCTGTCACAGAAACAGGCGTAGAGCTCTCA
AATGAAGAACGAAATTTACTGTCAGTTGCTTACAAAAATGTAGTCGGAGCCAGACGATCA
TCATGGCGTGTAATTTCATCAATTGAACAAAAAACCGAATCCTCAGCTCGAAAGCAACAG
TTGGCCCGAGAATACAGAGAGCGTGTTGAAAAAGAGCTTAGGGAAATTTGTTATGAAGTG
CTGGGACTTTTGGATAAATTTTTAATTCCCAAAGCCAGTAATCCAGAAAGTAAAGTCTTC
TACTTGAAAATGAAAGGCGATTACTACAGATATTTAGCAGAAGTTGCTACCGGTGAAACA
CGCAACTCCGTAGTTGATGACTCACAAGCAGCATACCAAGATGCATTTGAGATTA

>g10748.t83 Gene=g10748 Length=158
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRS
SWRVISSIEQKTESSARKQQLAREYRERVEKELREICYEVLGLLDKFLIPKASNPESKVF
YLKMKGDYYRYLAEVATGETRNSVVDDSQAAYQDAFEI

Protein features from InterProScan

Transcript Database ID Name Start End E.value
10 g10748.t83 Coils Coil Coil 75 95 -
9 g10748.t83 Gene3D G3DSA:1.20.190.20 - 1 158 5.0E-74
2 g10748.t83 PANTHER PTHR18860 14-3-3 PROTEIN 5 158 1.8E-78
3 g10748.t83 PANTHER PTHR18860:SF7 14-3-3 PROTEIN ZETA/DELTA 5 158 1.8E-78
6 g10748.t83 PRINTS PR00305 14-3-3 protein zeta signature 38 67 2.5E-39
7 g10748.t83 PRINTS PR00305 14-3-3 protein zeta signature 85 109 2.5E-39
5 g10748.t83 PRINTS PR00305 14-3-3 protein zeta signature 116 138 2.5E-39
4 g10748.t83 PRINTS PR00305 14-3-3 protein zeta signature 151 158 2.5E-39
1 g10748.t83 Pfam PF00244 14-3-3 protein 12 158 4.8E-62
11 g10748.t83 ProSitePatterns PS00796 14-3-3 proteins signature 1. 44 54 -
12 g10748.t83 SMART SM00101 1433_4 6 158 1.3E-38
8 g10748.t83 SUPERFAMILY SSF48445 14-3-3 protein 5 158 3.92E-63

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed