General information for g10748.t97
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as 14-3-3 protein zeta.
Parent gene
- The parent gene g10748 is located on chr_1: 11694759..11696924 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10748 | g10748.t97 | TSS | g10748.t97 | 11691231 | 11691231 |
| chr_1 | g10748 | g10748.t97 | isoform | g10748.t97 | 11692201 | 11694882 |
| chr_1 | g10748 | g10748.t97 | exon | g10748.t97.exon1 | 11692201 | 11692309 |
| chr_1 | g10748 | g10748.t97 | cds | g10748.t97.CDS1 | 11692252 | 11692309 |
| chr_1 | g10748 | g10748.t97 | exon | g10748.t97.exon2 | 11692597 | 11692760 |
| chr_1 | g10748 | g10748.t97 | cds | g10748.t97.CDS2 | 11692597 | 11692760 |
| chr_1 | g10748 | g10748.t97 | exon | g10748.t97.exon3 | 11694727 | 11694882 |
| chr_1 | g10748 | g10748.t97 | cds | g10748.t97.CDS3 | 11694727 | 11694882 |
| chr_1 | g10748 | g10748.t97 | TTS | g10748.t97 | 11695497 | 11695497 |
Sequences
>g10748.t97 Gene=g10748 Length=429
TTTTTAATTCCCAAAGCCAGTAATCCAGAAAGTAAAGTCTTCTACTTGAAAATGAAAGGC
GATTACTACAGATATTTAGCAGAAGTTGCTACCGGTGAAACACGCAACTCCGTAGTTGAT
GACTCACAAGCAGCATACCAAGATGCATTTGAGATTAGTAAGGGCAAAATGCAACCAACA
CATCCAATACGTTTAGGCTTGGCATTAAACTTCTCCGTCTTTTATTATGAGATACTCAGC
TCTCCCGAGAAAGCATGCGCTTTGGCAAAGCAGGCTTTCGATGACGCTATCGCAGAATTG
GACACACTAAATGAGGACTCATATAAAGATTCAACCCTTATCATGCAGCTGTTGAGAGAT
AACCTTACTTTATGGACATCTGATACGCAAGGGGACGGTGATGAAGCACCAGTTGGAGAT
GATAACTAA
>g10748.t97 Gene=g10748 Length=125
MKGDYYRYLAEVATGETRNSVVDDSQAAYQDAFEISKGKMQPTHPIRLGLALNFSVFYYE
ILSSPEKACALAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDEAP
VGDDN
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g10748.t97 | Coils | Coil | Coil | 69 | 89 | - |
| 8 | g10748.t97 | Gene3D | G3DSA:1.20.190.20 | - | 1 | 125 | 2.4E-61 |
| 2 | g10748.t97 | PANTHER | PTHR18860 | 14-3-3 PROTEIN | 1 | 122 | 5.0E-68 |
| 3 | g10748.t97 | PANTHER | PTHR18860:SF7 | 14-3-3 PROTEIN ZETA/DELTA | 1 | 122 | 5.0E-68 |
| 6 | g10748.t97 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 28 | 54 | 1.1E-42 |
| 4 | g10748.t97 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 55 | 81 | 1.1E-42 |
| 5 | g10748.t97 | PRINTS | PR00305 | 14-3-3 protein zeta signature | 82 | 111 | 1.1E-42 |
| 1 | g10748.t97 | Pfam | PF00244 | 14-3-3 protein | 1 | 109 | 1.1E-55 |
| 10 | g10748.t97 | ProSitePatterns | PS00797 | 14-3-3 proteins signature 2. | 91 | 110 | - |
| 11 | g10748.t97 | SMART | SM00101 | 1433_4 | 1 | 122 | 1.3E-25 |
| 7 | g10748.t97 | SUPERFAMILY | SSF48445 | 14-3-3 protein | 1 | 117 | 2.49E-54 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
