General information for g10749.t12
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as hypothetical.
Parent gene
- The parent gene g10749 is located on chr_1: 11703097..11706214 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10749 | g10749.t12 | isoform | g10749.t12 | 11699680 | 11702541 |
| chr_1 | g10749 | g10749.t12 | exon | g10749.t12.exon1 | 11699680 | 11699686 |
| chr_1 | g10749 | g10749.t12 | exon | g10749.t12.exon2 | 11701464 | 11701572 |
| chr_1 | g10749 | g10749.t12 | exon | g10749.t12.exon3 | 11702119 | 11702271 |
| chr_1 | g10749 | g10749.t12 | cds | g10749.t12.CDS1 | 11702203 | 11702271 |
| chr_1 | g10749 | g10749.t12 | exon | g10749.t12.exon4 | 11702336 | 11702371 |
| chr_1 | g10749 | g10749.t12 | cds | g10749.t12.CDS2 | 11702336 | 11702371 |
| chr_1 | g10749 | g10749.t12 | exon | g10749.t12.exon5 | 11702510 | 11702541 |
| chr_1 | g10749 | g10749.t12 | cds | g10749.t12.CDS3 | 11702510 | 11702539 |
| chr_1 | g10749 | g10749.t12 | TSS | g10749.t12 | NA | NA |
| chr_1 | g10749 | g10749.t12 | TTS | g10749.t12 | NA | NA |
Sequences
>g10749.t12 Gene=g10749 Length=337
ACTGTGGTTACTTAGCTGTAGTCGCTGCGCTTGCTTCAGAAGCTGACTACGTATTTATAC
CTGAGGATCCTGTCAACGTTCACTGGAAAGAGAATCTGTGCAAAAAATTACTTCAGGAAC
GTTCTGCTGGTCAGCGTTTAAACATTATAATTGTTGCTGAAGGAGCTATTGATCGTGAAG
GTAATCCTATTACAGCTGAAATGGTTAAGAAAGTAGTCGTTGATGAATTGAAACAAGACA
CAAGAATCACTGTTTTGGGTCATGTACAGAGAGGAGGAAATCCTTCAGCTTTCGATCGTG
TTTTGCATGGGCGCAGAAGCTGTTATGGCTTTGATGG
>g10749.t12 Gene=g10749 Length=45
MVKKVVVDELKQDTRITVLGHVQRGGNPSAFDRVLHGRRSCYGFD
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 4 | g10749.t12 | Gene3D | G3DSA:3.40.50.460 | - | 1 | 43 | 3.0E-11 |
| 1 | g10749.t12 | Pfam | PF00365 | Phosphofructokinase | 2 | 38 | 6.6E-10 |
| 3 | g10749.t12 | ProSitePatterns | PS00433 | Phosphofructokinase signature. | 15 | 33 | - |
| 2 | g10749.t12 | SUPERFAMILY | SSF53784 | Phosphofructokinase | 3 | 37 | 1.44E-8 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0003872 | 6-phosphofructokinase activity | MF |
| GO:0006096 | glycolytic process | BP |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed