General information for g10800.t10
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Annexin B9.
Parent gene
- The parent gene g10800 is located on chr_1: 12053250..12057223 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10800 | g10800.t10 | TTS | g10800.t10 | 12050020 | 12050020 |
| chr_1 | g10800 | g10800.t10 | isoform | g10800.t10 | 12050198 | 12053098 |
| chr_1 | g10800 | g10800.t10 | exon | g10800.t10.exon1 | 12050198 | 12050251 |
| chr_1 | g10800 | g10800.t10 | cds | g10800.t10.CDS1 | 12050198 | 12050251 |
| chr_1 | g10800 | g10800.t10 | exon | g10800.t10.exon2 | 12052686 | 12052867 |
| chr_1 | g10800 | g10800.t10 | cds | g10800.t10.CDS2 | 12052686 | 12052867 |
| chr_1 | g10800 | g10800.t10 | exon | g10800.t10.exon3 | 12052960 | 12053098 |
| chr_1 | g10800 | g10800.t10 | cds | g10800.t10.CDS3 | 12052960 | 12053035 |
| chr_1 | g10800 | g10800.t10 | TSS | g10800.t10 | NA | NA |
Sequences
>g10800.t10 Gene=g10800 Length=375
AATCAAATTCTTGTAACCAGATCATACCAACAATTGAGACAAGTCTTTTTGGAATATGAG
GCTATGAGCGGCCACGACATTGAAAAAGCTATCAAGCGTGAATTCTCAGGAAACGCTGAA
AAAGGATTCCTCGCAATCGCCAAGGTTGTCAAATCAAAGGTTGATTTCTTTGCTGAAAAA
CTCTACGAGAGCATGAAGGGCTTAGGTACGAATGACAAGACATTGATTCGTATCATTGTT
TCACGCTCAGAAATTGATTTGGGTGACATCAAAGAAGCATTTGAAGCCAAGTATGGAAAA
AGCCTCGAGAGCTGGGTTAAGGATGAACTATCGAGTGATTATGAGCGAGTTATGGTTTGC
CTTCTTGGATCTTAA
>g10800.t10 Gene=g10800 Length=103
MSGHDIEKAIKREFSGNAEKGFLAIAKVVKSKVDFFAEKLYESMKGLGTNDKTLIRIIVS
RSEIDLGDIKEAFEAKYGKSLESWVKDELSSDYERVMVCLLGS
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g10800.t10 | Gene3D | G3DSA:1.10.220.10 | - | 1 | 31 | 1.3E-5 |
| 8 | g10800.t10 | Gene3D | G3DSA:1.10.220.10 | - | 33 | 103 | 3.9E-27 |
| 3 | g10800.t10 | PANTHER | PTHR10502 | ANNEXIN | 2 | 101 | 5.2E-41 |
| 4 | g10800.t10 | PANTHER | PTHR10502:SF212 | ANNEXIN B9 | 2 | 101 | 5.2E-41 |
| 5 | g10800.t10 | PRINTS | PR00196 | Annexin family signature | 45 | 67 | 1.6E-6 |
| 6 | g10800.t10 | PRINTS | PR00196 | Annexin family signature | 85 | 101 | 1.6E-6 |
| 2 | g10800.t10 | Pfam | PF00191 | Annexin | 1 | 25 | 1.4E-4 |
| 1 | g10800.t10 | Pfam | PF00191 | Annexin | 35 | 100 | 4.1E-24 |
| 10 | g10800.t10 | ProSitePatterns | PS00223 | Annexin repeat signature. | 48 | 100 | - |
| 12 | g10800.t10 | ProSiteProfiles | PS51897 | Annexin repeat profile. | 1 | 27 | 11.37 |
| 13 | g10800.t10 | ProSiteProfiles | PS51897 | Annexin repeat profile. | 31 | 102 | 27.946 |
| 11 | g10800.t10 | SMART | SM00335 | annex3 | 48 | 100 | 6.2E-23 |
| 7 | g10800.t10 | SUPERFAMILY | SSF47874 | Annexin | 1 | 102 | 1.19E-35 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005544 | calcium-dependent phospholipid binding | MF |
| GO:0005509 | calcium ion binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
