Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Annexin B9.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g10800 g10800.t10 TTS g10800.t10 12050020 12050020
chr_1 g10800 g10800.t10 isoform g10800.t10 12050198 12053098
chr_1 g10800 g10800.t10 exon g10800.t10.exon1 12050198 12050251
chr_1 g10800 g10800.t10 cds g10800.t10.CDS1 12050198 12050251
chr_1 g10800 g10800.t10 exon g10800.t10.exon2 12052686 12052867
chr_1 g10800 g10800.t10 cds g10800.t10.CDS2 12052686 12052867
chr_1 g10800 g10800.t10 exon g10800.t10.exon3 12052960 12053098
chr_1 g10800 g10800.t10 cds g10800.t10.CDS3 12052960 12053035
chr_1 g10800 g10800.t10 TSS g10800.t10 NA NA

Sequences

>g10800.t10 Gene=g10800 Length=375
AATCAAATTCTTGTAACCAGATCATACCAACAATTGAGACAAGTCTTTTTGGAATATGAG
GCTATGAGCGGCCACGACATTGAAAAAGCTATCAAGCGTGAATTCTCAGGAAACGCTGAA
AAAGGATTCCTCGCAATCGCCAAGGTTGTCAAATCAAAGGTTGATTTCTTTGCTGAAAAA
CTCTACGAGAGCATGAAGGGCTTAGGTACGAATGACAAGACATTGATTCGTATCATTGTT
TCACGCTCAGAAATTGATTTGGGTGACATCAAAGAAGCATTTGAAGCCAAGTATGGAAAA
AGCCTCGAGAGCTGGGTTAAGGATGAACTATCGAGTGATTATGAGCGAGTTATGGTTTGC
CTTCTTGGATCTTAA

>g10800.t10 Gene=g10800 Length=103
MSGHDIEKAIKREFSGNAEKGFLAIAKVVKSKVDFFAEKLYESMKGLGTNDKTLIRIIVS
RSEIDLGDIKEAFEAKYGKSLESWVKDELSSDYERVMVCLLGS

Protein features from InterProScan

Transcript Database ID Name Start End E.value
9 g10800.t10 Gene3D G3DSA:1.10.220.10 - 1 31 1.3E-5
8 g10800.t10 Gene3D G3DSA:1.10.220.10 - 33 103 3.9E-27
3 g10800.t10 PANTHER PTHR10502 ANNEXIN 2 101 5.2E-41
4 g10800.t10 PANTHER PTHR10502:SF212 ANNEXIN B9 2 101 5.2E-41
5 g10800.t10 PRINTS PR00196 Annexin family signature 45 67 1.6E-6
6 g10800.t10 PRINTS PR00196 Annexin family signature 85 101 1.6E-6
2 g10800.t10 Pfam PF00191 Annexin 1 25 1.4E-4
1 g10800.t10 Pfam PF00191 Annexin 35 100 4.1E-24
10 g10800.t10 ProSitePatterns PS00223 Annexin repeat signature. 48 100 -
12 g10800.t10 ProSiteProfiles PS51897 Annexin repeat profile. 1 27 11.37
13 g10800.t10 ProSiteProfiles PS51897 Annexin repeat profile. 31 102 27.946
11 g10800.t10 SMART SM00335 annex3 48 100 6.2E-23
7 g10800.t10 SUPERFAMILY SSF47874 Annexin 1 102 1.19E-35

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0005544 calcium-dependent phospholipid binding MF
GO:0005509 calcium ion binding MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values