General information for g10800.t122
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Annexin B9.
Parent gene
- The parent gene g10800 is located on chr_1: 12053250..12057223 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10800 | g10800.t122 | isoform | g10800.t122 | 12053038 | 12053869 |
| chr_1 | g10800 | g10800.t122 | exon | g10800.t122.exon1 | 12053038 | 12053108 |
| chr_1 | g10800 | g10800.t122 | cds | g10800.t122.CDS1 | 12053039 | 12053108 |
| chr_1 | g10800 | g10800.t122 | exon | g10800.t122.exon2 | 12053171 | 12053303 |
| chr_1 | g10800 | g10800.t122 | cds | g10800.t122.CDS2 | 12053171 | 12053303 |
| chr_1 | g10800 | g10800.t122 | exon | g10800.t122.exon3 | 12053380 | 12053508 |
| chr_1 | g10800 | g10800.t122 | cds | g10800.t122.CDS3 | 12053380 | 12053508 |
| chr_1 | g10800 | g10800.t122 | exon | g10800.t122.exon4 | 12053572 | 12053869 |
| chr_1 | g10800 | g10800.t122 | cds | g10800.t122.CDS4 | 12053572 | 12053800 |
| chr_1 | g10800 | g10800.t122 | TSS | g10800.t122 | 12054437 | 12054437 |
| chr_1 | g10800 | g10800.t122 | TTS | g10800.t122 | NA | NA |
Sequences
>g10800.t122 Gene=g10800 Length=631
TGCAAACCAACCGTTTACCCTGCCGATCCTTTTGACCCAAATGAAGATGCAGGTATCTTG
AGAAAGGCAATGAAAGGATTTGGAACTGATGAAAAGGCAATTATTGAAGTGCTTGCTCGT
CGTGGAATTGTTCAACGTCTTGAGATTGCTTCGGCATATAAGACCAACTTTGGCAAGGAT
TTGATTAATGATTTGAAAAGTGAACTTGGTGGCAAGTTTGAAGATGTCATTCTTGCTTTG
ATGACTCCTTTGCCGCAATTCTATGCAAAGGAATTGCATGATGCAATTTCCGGCATTGGA
ACTGACGAAGACGCTATCATCGAAATTCTCTGCACACTCTCCAACTATGGCATTCGTACA
ATTGCAGAATTCTACGAACAACTGTATGGAAATTCACTCGAAAGCGACTTGAAGGGAGAC
ACCTCAGGATTCTTTAAGCGTTTATGCGTATCATTAGTGCAAGGCAATCGCGATGAAAAC
AATGGTGTTGATCAAGGTTCTGCTCTTGCTGATGCTACTGCACTTTATGAAGCCGGTGAA
GGACAATGGGGCACTGATGAGTCAGTTTTCAATCAAATTCTTGTAACCAGATCATACCAA
CAATTGAGACAAGTCTTTTTGGAATATGAGG
>g10800.t122 Gene=g10800 Length=187
MKGFGTDEKAIIEVLARRGIVQRLEIASAYKTNFGKDLINDLKSELGGKFEDVILALMTP
LPQFYAKELHDAISGIGTDEDAIIEILCTLSNYGIRTIAEFYEQLYGNSLESDLKGDTSG
FFKRLCVSLVQGNRDENNGVDQGSALADATALYEAGEGQWGTDESVFNQILVTRSYQQLR
QVFLEYE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 12 | g10800.t122 | Gene3D | G3DSA:1.10.220.10 | - | 1 | 59 | 9.5E-22 |
| 13 | g10800.t122 | Gene3D | G3DSA:1.10.220.10 | - | 61 | 132 | 2.4E-26 |
| 11 | g10800.t122 | Gene3D | G3DSA:1.10.220.10 | - | 133 | 187 | 2.1E-17 |
| 4 | g10800.t122 | PANTHER | PTHR10502 | ANNEXIN | 1 | 187 | 1.9E-78 |
| 5 | g10800.t122 | PANTHER | PTHR10502:SF212 | ANNEXIN B9 | 1 | 187 | 1.9E-78 |
| 8 | g10800.t122 | PRINTS | PR00196 | Annexin family signature | 2 | 24 | 2.6E-38 |
| 7 | g10800.t122 | PRINTS | PR00196 | Annexin family signature | 42 | 58 | 2.6E-38 |
| 9 | g10800.t122 | PRINTS | PR00196 | Annexin family signature | 69 | 90 | 2.6E-38 |
| 6 | g10800.t122 | PRINTS | PR00196 | Annexin family signature | 152 | 178 | 2.6E-38 |
| 3 | g10800.t122 | Pfam | PF00191 | Annexin | 1 | 57 | 9.0E-19 |
| 2 | g10800.t122 | Pfam | PF00191 | Annexin | 65 | 129 | 8.8E-23 |
| 1 | g10800.t122 | Pfam | PF00191 | Annexin | 148 | 187 | 8.0E-12 |
| 14 | g10800.t122 | ProSitePatterns | PS00223 | Annexin repeat signature. | 5 | 57 | - |
| 18 | g10800.t122 | ProSiteProfiles | PS51897 | Annexin repeat profile. | 1 | 59 | 23.568 |
| 17 | g10800.t122 | ProSiteProfiles | PS51897 | Annexin repeat profile. | 60 | 131 | 27.041 |
| 19 | g10800.t122 | ProSiteProfiles | PS51897 | Annexin repeat profile. | 143 | 187 | 18.309 |
| 15 | g10800.t122 | SMART | SM00335 | annex3 | 5 | 57 | 4.1E-22 |
| 16 | g10800.t122 | SMART | SM00335 | annex3 | 77 | 129 | 3.3E-21 |
| 10 | g10800.t122 | SUPERFAMILY | SSF47874 | Annexin | 1 | 187 | 2.09E-70 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005544 | calcium-dependent phospholipid binding | MF |
| GO:0005509 | calcium ion binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed