Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Annexin B9.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g10800 g10800.t124 isoform g10800.t124 12053161 12053662
chr_1 g10800 g10800.t124 exon g10800.t124.exon1 12053161 12053303
chr_1 g10800 g10800.t124 cds g10800.t124.CDS1 12053161 12053303
chr_1 g10800 g10800.t124 exon g10800.t124.exon2 12053380 12053508
chr_1 g10800 g10800.t124 cds g10800.t124.CDS2 12053380 12053508
chr_1 g10800 g10800.t124 exon g10800.t124.exon3 12053572 12053662
chr_1 g10800 g10800.t124 cds g10800.t124.CDS3 12053572 12053629
chr_1 g10800 g10800.t124 TSS g10800.t124 12054437 12054437
chr_1 g10800 g10800.t124 TTS g10800.t124 NA NA

Sequences

>g10800.t124 Gene=g10800 Length=363
GGTGGCAAGTTTGAAGATGTCATTCTTGCTTTGATGACTCCTTTGCCGCAATTCTATGCA
AAGGAATTGCATGATGCAATTTCCGGCATTGGAACTGACGAAGACGCTATCATCGAAATT
CTCTGCACACTCTCCAACTATGGCATTCGTACAATTGCAGAATTCTACGAACAACTGTAT
GGAAATTCACTCGAAAGCGACTTGAAGGGAGACACCTCAGGATTCTTTAAGCGTTTATGC
GTATCATTAGTGCAAGGCAATCGCGATGAAAACAATGGTGTTGATCAAGGTTCTGCTCTT
GCTGATGCTACTGCACTTTATGAAGCCGGTGAAGGACAATGGGGCACTGATGAGTATTTT
TTT

>g10800.t124 Gene=g10800 Length=110
MTPLPQFYAKELHDAISGIGTDEDAIIEILCTLSNYGIRTIAEFYEQLYGNSLESDLKGD
TSGFFKRLCVSLVQGNRDENNGVDQGSALADATALYEAGEGQWGTDEYFF

Protein features from InterProScan

Transcript Database ID Name Start End E.value
8 g10800.t124 Gene3D G3DSA:1.10.220.10 - 3 75 0.0000000
9 g10800.t124 Gene3D G3DSA:1.10.220.10 - 76 110 0.0000014
2 g10800.t124 PANTHER PTHR10502 ANNEXIN 4 110 0.0000000
3 g10800.t124 PANTHER PTHR10502:SF212 ANNEXIN B9 4 110 0.0000000
5 g10800.t124 PRINTS PR00196 Annexin family signature 12 33 0.0000000
4 g10800.t124 PRINTS PR00196 Annexin family signature 95 110 0.0000000
1 g10800.t124 Pfam PF00191 Annexin 8 72 0.0000000
11 g10800.t124 ProSiteProfiles PS51897 Annexin repeat profile. 3 74 27.0410000
10 g10800.t124 ProSiteProfiles PS51897 Annexin repeat profile. 86 110 8.7020000
7 g10800.t124 SMART SM00335 annex3 20 72 0.0000000
6 g10800.t124 SUPERFAMILY SSF47874 Annexin 1 109 0.0000000

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0005544 calcium-dependent phospholipid binding MF
GO:0005509 calcium ion binding MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed