General information for g10800.t124
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative Annexin B9.
Parent gene
- The parent gene g10800 is located on chr_1: 12053250..12057223 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10800 | g10800.t124 | isoform | g10800.t124 | 12053161 | 12053662 |
| chr_1 | g10800 | g10800.t124 | exon | g10800.t124.exon1 | 12053161 | 12053303 |
| chr_1 | g10800 | g10800.t124 | cds | g10800.t124.CDS1 | 12053161 | 12053303 |
| chr_1 | g10800 | g10800.t124 | exon | g10800.t124.exon2 | 12053380 | 12053508 |
| chr_1 | g10800 | g10800.t124 | cds | g10800.t124.CDS2 | 12053380 | 12053508 |
| chr_1 | g10800 | g10800.t124 | exon | g10800.t124.exon3 | 12053572 | 12053662 |
| chr_1 | g10800 | g10800.t124 | cds | g10800.t124.CDS3 | 12053572 | 12053629 |
| chr_1 | g10800 | g10800.t124 | TSS | g10800.t124 | 12054437 | 12054437 |
| chr_1 | g10800 | g10800.t124 | TTS | g10800.t124 | NA | NA |
Sequences
>g10800.t124 Gene=g10800 Length=363
GGTGGCAAGTTTGAAGATGTCATTCTTGCTTTGATGACTCCTTTGCCGCAATTCTATGCA
AAGGAATTGCATGATGCAATTTCCGGCATTGGAACTGACGAAGACGCTATCATCGAAATT
CTCTGCACACTCTCCAACTATGGCATTCGTACAATTGCAGAATTCTACGAACAACTGTAT
GGAAATTCACTCGAAAGCGACTTGAAGGGAGACACCTCAGGATTCTTTAAGCGTTTATGC
GTATCATTAGTGCAAGGCAATCGCGATGAAAACAATGGTGTTGATCAAGGTTCTGCTCTT
GCTGATGCTACTGCACTTTATGAAGCCGGTGAAGGACAATGGGGCACTGATGAGTATTTT
TTT
>g10800.t124 Gene=g10800 Length=110
MTPLPQFYAKELHDAISGIGTDEDAIIEILCTLSNYGIRTIAEFYEQLYGNSLESDLKGD
TSGFFKRLCVSLVQGNRDENNGVDQGSALADATALYEAGEGQWGTDEYFF
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g10800.t124 | Gene3D | G3DSA:1.10.220.10 | - | 3 | 75 | 0.0000000 |
| 9 | g10800.t124 | Gene3D | G3DSA:1.10.220.10 | - | 76 | 110 | 0.0000014 |
| 2 | g10800.t124 | PANTHER | PTHR10502 | ANNEXIN | 4 | 110 | 0.0000000 |
| 3 | g10800.t124 | PANTHER | PTHR10502:SF212 | ANNEXIN B9 | 4 | 110 | 0.0000000 |
| 5 | g10800.t124 | PRINTS | PR00196 | Annexin family signature | 12 | 33 | 0.0000000 |
| 4 | g10800.t124 | PRINTS | PR00196 | Annexin family signature | 95 | 110 | 0.0000000 |
| 1 | g10800.t124 | Pfam | PF00191 | Annexin | 8 | 72 | 0.0000000 |
| 11 | g10800.t124 | ProSiteProfiles | PS51897 | Annexin repeat profile. | 3 | 74 | 27.0410000 |
| 10 | g10800.t124 | ProSiteProfiles | PS51897 | Annexin repeat profile. | 86 | 110 | 8.7020000 |
| 7 | g10800.t124 | SMART | SM00335 | annex3 | 20 | 72 | 0.0000000 |
| 6 | g10800.t124 | SUPERFAMILY | SSF47874 | Annexin | 1 | 109 | 0.0000000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005544 | calcium-dependent phospholipid binding | MF |
| GO:0005509 | calcium ion binding | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed