Gene loci information

Transcript annotation

  • This transcript has been annotated as Annexin B9.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g10800 g10800.t126 isoform g10800.t126 12053250 12054207
chr_1 g10800 g10800.t126 exon g10800.t126.exon1 12053250 12053303
chr_1 g10800 g10800.t126 cds g10800.t126.CDS1 12053251 12053303
chr_1 g10800 g10800.t126 exon g10800.t126.exon2 12053380 12053508
chr_1 g10800 g10800.t126 cds g10800.t126.CDS2 12053380 12053508
chr_1 g10800 g10800.t126 exon g10800.t126.exon3 12053572 12053869
chr_1 g10800 g10800.t126 cds g10800.t126.CDS3 12053572 12053869
chr_1 g10800 g10800.t126 exon g10800.t126.exon4 12054193 12054207
chr_1 g10800 g10800.t126 cds g10800.t126.CDS4 12054193 12054207
chr_1 g10800 g10800.t126 TSS g10800.t126 12054437 12054437
chr_1 g10800 g10800.t126 TTS g10800.t126 NA NA

Sequences

>g10800.t126 Gene=g10800 Length=496
ATGAGTAAAAGAACGTGCAAACCAACCGTTTACCCTGCCGATCCTTTTGACCCAAATGAA
GATGCAGGTATCTTGAGAAAGGCAATGAAAGGATTTGGAACTGATGAAAAGGCAATTATT
GAAGTGCTTGCTCGTCGTGGAATTGTTCAACGTCTTGAGATTGCTTCGGCATATAAGACC
AACTTTGGCAAGGATTTGATTAATGATTTGAAAAGTGAACTTGGTGGCAAGTTTGAAGAT
GTCATTCTTGCTTTGATGACTCCTTTGCCGCAATTCTATGCAAAGGAATTGCATGATGCA
ATTTCCGGCATTGGAACTGACGAAGACGCTATCATCGAAATTCTCTGCACACTCTCCAAC
TATGGCATTCGTACAATTGCAGAATTCTACGAACAACTGTATGGAAATTCACTCGAAAGC
GACTTGAAGGGAGACACCTCAGGATTCTTTAAGCGTTTATGCGTATCATTAGTGCAAGGC
AATCGCGATGAAAACA

>g10800.t126 Gene=g10800 Length=165
MSKRTCKPTVYPADPFDPNEDAGILRKAMKGFGTDEKAIIEVLARRGIVQRLEIASAYKT
NFGKDLINDLKSELGGKFEDVILALMTPLPQFYAKELHDAISGIGTDEDAIIEILCTLSN
YGIRTIAEFYEQLYGNSLESDLKGDTSGFFKRLCVSLVQGNRDEN

Protein features from InterProScan

Transcript Database ID Name Start End E.value
13 g10800.t126 Gene3D G3DSA:1.10.220.10 - 15 87 3.5E-28
14 g10800.t126 Gene3D G3DSA:1.10.220.10 - 89 161 1.8E-26
3 g10800.t126 PANTHER PTHR10502 ANNEXIN 4 165 1.1E-64
4 g10800.t126 PANTHER PTHR10502:SF212 ANNEXIN B9 4 165 1.1E-64
11 g10800.t126 PRINTS PR00196 Annexin family signature 30 52 2.9E-24
5 g10800.t126 PRINTS PR00200 Annexin type IV signature 41 50 9.1E-5
7 g10800.t126 PRINTS PR00200 Annexin type IV signature 52 62 9.1E-5
9 g10800.t126 PRINTS PR00196 Annexin family signature 70 86 2.9E-24
6 g10800.t126 PRINTS PR00200 Annexin type IV signature 80 95 9.1E-5
10 g10800.t126 PRINTS PR00196 Annexin family signature 97 118 2.9E-24
8 g10800.t126 PRINTS PR00200 Annexin type IV signature 122 136 9.1E-5
2 g10800.t126 Pfam PF00191 Annexin 21 85 6.2E-23
1 g10800.t126 Pfam PF00191 Annexin 93 157 6.7E-23
15 g10800.t126 ProSitePatterns PS00223 Annexin repeat signature. 33 85 -
19 g10800.t126 ProSiteProfiles PS51897 Annexin repeat profile. 16 87 26.995
18 g10800.t126 ProSiteProfiles PS51897 Annexin repeat profile. 88 159 27.041
16 g10800.t126 SMART SM00335 annex3 33 85 4.1E-22
17 g10800.t126 SMART SM00335 annex3 105 157 3.3E-21
12 g10800.t126 SUPERFAMILY SSF47874 Annexin 6 165 3.8E-60

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0005544 calcium-dependent phospholipid binding MF
GO:0005509 calcium ion binding MF

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed