General information for g10840.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative CG16817-like protein.
Parent gene
- The parent gene g10840 is located on chr_1: 12217327..12218188 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10840 | g10840.t1 | TTS | g10840.t1 | 12216105 | 12216105 |
| chr_1 | g10840 | g10840.t1 | isoform | g10840.t1 | 12216483 | 12217439 |
| chr_1 | g10840 | g10840.t1 | exon | g10840.t1.exon1 | 12216483 | 12216924 |
| chr_1 | g10840 | g10840.t1 | cds | g10840.t1.CDS1 | 12216483 | 12216924 |
| chr_1 | g10840 | g10840.t1 | exon | g10840.t1.exon2 | 12216991 | 12217071 |
| chr_1 | g10840 | g10840.t1 | cds | g10840.t1.CDS2 | 12216991 | 12217071 |
| chr_1 | g10840 | g10840.t1 | exon | g10840.t1.exon3 | 12217423 | 12217439 |
| chr_1 | g10840 | g10840.t1 | cds | g10840.t1.CDS3 | 12217423 | 12217439 |
| chr_1 | g10840 | g10840.t1 | TSS | g10840.t1 | 12217517 | 12217517 |
Sequences
>g10840.t1 Gene=g10840 Length=540
ATGTCGTCAACTACAGTAAATCCTCCTGTTTCTTGGGCACAGCGTAATGATGTTCTTTTT
GTAACAATCAACGTAGAAACAAAAGATCCTGAAATTAAATTCACAGAGGATTCTTTATAT
TTCAAAGGCGTTGGCTTGCCAGAAAATAAAAAATATGAAGTGACGATTAATTTTTATAAG
AAAATCAATCCAGACAATGTTAAGAGTAAAAACAGTGGACGATGCATTGAATTTGTCATT
ACCAAAGCCGATACAAAATCCGAATATTGGCCATCGCTGGTGAGCGATAAGAAAAAGCCA
CATTATCTTATAGTAGATTTTAATAAGTGGAAAGACGAAGGATCAGATGACGATGAAGAG
CCGGGTTTTAATGATAACTTTGGTGGTATGGGCAATTTTAATGATTTAATGAGCTCGATG
GGAGGTGGTGCAGGAATCGGTGGTGCCGGTGGAGATGGTAAACCTTCATTCGATGACCTC
GAAGATGAAGAAGATAGTGACGACGAACAGATACCAGATTTGGAAGAAGCTAAAAAGTGA
>g10840.t1 Gene=g10840 Length=179
MSSTTVNPPVSWAQRNDVLFVTINVETKDPEIKFTEDSLYFKGVGLPENKKYEVTINFYK
KINPDNVKSKNSGRCIEFVITKADTKSEYWPSLVSDKKKPHYLIVDFNKWKDEGSDDDEE
PGFNDNFGGMGNFNDLMSSMGGGAGIGGAGGDGKPSFDDLEDEEDSDDEQIPDLEEAKK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g10840.t1 | CDD | cd06465 | p23_hB-ind1_like | 8 | 113 | 1.16714E-47 |
| 6 | g10840.t1 | Coils | Coil | Coil | 175 | 179 | - |
| 5 | g10840.t1 | Gene3D | G3DSA:2.60.40.790 | - | 6 | 128 | 2.7E-32 |
| 9 | g10840.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 139 | 179 | - |
| 8 | g10840.t1 | MobiDBLite | mobidb-lite | consensus disorder prediction | 157 | 171 | - |
| 2 | g10840.t1 | PANTHER | PTHR22932:SF1 | CO-CHAPERONE PROTEIN DAF-41 | 1 | 168 | 2.1E-36 |
| 3 | g10840.t1 | PANTHER | PTHR22932 | TELOMERASE-BINDING PROTEIN P23 HSP90 CO-CHAPERONE | 1 | 168 | 2.1E-36 |
| 1 | g10840.t1 | Pfam | PF04969 | CS domain | 9 | 82 | 3.5E-8 |
| 10 | g10840.t1 | ProSiteProfiles | PS51203 | CS domain profile. | 5 | 94 | 17.857 |
| 4 | g10840.t1 | SUPERFAMILY | SSF49764 | HSP20-like chaperones | 6 | 113 | 1.92E-29 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K15730 (cytosolic prostaglandin-E synthase)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
