General information for g10849.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative DNA-directed RNA polymerases I and III subunit RPAC2.
Parent gene
- The parent gene g10849 is located on chr_1: 12251693..12252110 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10849 | g10849.t1 | TTS | g10849.t1 | 12251666 | 12251666 |
| chr_1 | g10849 | g10849.t1 | isoform | g10849.t1 | 12251693 | 12252110 |
| chr_1 | g10849 | g10849.t1 | exon | g10849.t1.exon1 | 12251693 | 12251867 |
| chr_1 | g10849 | g10849.t1 | cds | g10849.t1.CDS1 | 12251693 | 12251867 |
| chr_1 | g10849 | g10849.t1 | exon | g10849.t1.exon2 | 12251931 | 12252031 |
| chr_1 | g10849 | g10849.t1 | cds | g10849.t1.CDS2 | 12251931 | 12252031 |
| chr_1 | g10849 | g10849.t1 | exon | g10849.t1.exon3 | 12252087 | 12252110 |
| chr_1 | g10849 | g10849.t1 | cds | g10849.t1.CDS3 | 12252087 | 12252110 |
| chr_1 | g10849 | g10849.t1 | TSS | g10849.t1 | 12252126 | 12252126 |
Sequences
>g10849.t1 Gene=g10849 Length=300
ATGTCAACAAAGAGAATTACTATCAAACAGGATGGAGAAGAAGGCTCTGATCAAAATGTT
ACATTTGAGATTCAAGATGAAGGCCATACTTTGGGAAATGCGTTACAAAATATAATTTCG
CAATATCCAGATGTTGGTTTTTGTGGATATTCAATTCCTTCTTTTCTTGATAACTATCTA
AATTTTAAAATTCAAACTAAGAACAATGTCAAATCTGTCGACGTATTAAAAAGGGGATTA
GAAGATCTTATCTTTTTATGTGAACATATTTTAGATAAAACAAAGTCAGCTATGAAATAA
>g10849.t1 Gene=g10849 Length=99
MSTKRITIKQDGEEGSDQNVTFEIQDEGHTLGNALQNIISQYPDVGFCGYSIPSFLDNYL
NFKIQTKNNVKSVDVLKRGLEDLIFLCEHILDKTKSAMK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g10849.t1 | CDD | cd07029 | RNAP_I_III_AC19 | 19 | 93 | 0 |
| 5 | g10849.t1 | Gene3D | G3DSA:3.30.1360.10 | - | 2 | 99 | 0 |
| 2 | g10849.t1 | PANTHER | PTHR13946:SF28 | DNA-DIRECTED RNA POLYMERASES I AND III SUBUNIT RPAC2 | 13 | 98 | 0 |
| 3 | g10849.t1 | PANTHER | PTHR13946 | DNA-DIRECTED RNA POLYMERASE I,II,III | 13 | 98 | 0 |
| 1 | g10849.t1 | Pfam | PF13656 | RNA polymerase Rpb3/Rpb11 dimerisation domain | 19 | 92 | 0 |
| 4 | g10849.t1 | SUPERFAMILY | SSF55257 | RBP11-like subunits of RNA polymerase | 14 | 98 | 0 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006351 | transcription, DNA-templated | BP |
| GO:0046983 | protein dimerization activity | MF |
KEGG
Orthology
- This transcript has been annotated with K03020 (DNA-directed RNA polymerases I and III subunit RPAC2)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
