| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10901 | g10901.t2 | TTS | g10901.t2 | 12536846 | 12536846 |
| chr_1 | g10901 | g10901.t2 | isoform | g10901.t2 | 12536865 | 12537255 |
| chr_1 | g10901 | g10901.t2 | exon | g10901.t2.exon1 | 12536865 | 12537255 |
| chr_1 | g10901 | g10901.t2 | cds | g10901.t2.CDS1 | 12536865 | 12537245 |
| chr_1 | g10901 | g10901.t2 | TSS | g10901.t2 | 12537683 | 12537683 |
>g10901.t2 Gene=g10901 Length=391
CGCTTTGAGCATGTATCAACAAAAGAGACAAAAAAGAGAAATGGAAGCTACAGAAAGAGA
ACAATTATTAACAAGAAGATTTCAGCCTAATTCAGAAACAACTATAGATCTTGACTATTC
ACTTCAACACAATACACAAATGCAAAATGCACATAGAGGCGTAGATGAAATGCTTTCTAC
TGGCAATAATATAATTAATAGTTTAAGAAATCAACGAGATATATTGAAAGGTGCTCGTAC
TAGAATGTTGAATGTTGGTAGCACGCTTGGTCTTTCAGACCATACAATAAGGCTAATTGA
GAGGAGACTGACAGATGATCGATATGTTATGTTTGCAGGAATGTTTGTTACATTATGTAT
TATTGGCTTAGTTATTTATCTATTAGCTTAA
>g10901.t2 Gene=g10901 Length=126
MYQQKRQKREMEATEREQLLTRRFQPNSETTIDLDYSLQHNTQMQNAHRGVDEMLSTGNN
IINSLRNQRDILKGARTRMLNVGSTLGLSDHTIRLIERRLTDDRYVMFAGMFVTLCIIGL
VIYLLA
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g10901.t2 | CDD | cd15863 | SNARE_GS27 | 35 | 99 | 8.6031E-27 |
| 6 | g10901.t2 | Gene3D | G3DSA:1.20.5.110 | - | 29 | 104 | 2.4E-8 |
| 2 | g10901.t2 | PANTHER | PTHR21230 | VESICLE TRANSPORT V-SNARE PROTEIN VTI1-RELATED | 2 | 123 | 3.4E-37 |
| 3 | g10901.t2 | PANTHER | PTHR21230:SF1 | GOLGI SNAP RECEPTOR COMPLEX MEMBER 2 | 2 | 123 | 3.4E-37 |
| 1 | g10901.t2 | Pfam | PF12352 | Snare region anchored in the vesicle membrane C-terminus | 36 | 100 | 9.2E-18 |
| 7 | g10901.t2 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 1 | 104 | - |
| 9 | g10901.t2 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 105 | 125 | - |
| 8 | g10901.t2 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 126 | 126 | - |
| 5 | g10901.t2 | SUPERFAMILY | SSF58038 | SNARE fusion complex | 39 | 95 | 5.23E-9 |
| 4 | g10901.t2 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 106 | 125 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed