Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Chitinase-3-like protein 1.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g10923 g10923.t6 TSS g10923.t6 12730685 12730685
chr_1 g10923 g10923.t6 isoform g10923.t6 12731680 12732037
chr_1 g10923 g10923.t6 exon g10923.t6.exon1 12731680 12732037
chr_1 g10923 g10923.t6 cds g10923.t6.CDS1 12731721 12732035
chr_1 g10923 g10923.t6 TTS g10923.t6 NA NA

Sequences

>g10923.t6 Gene=g10923 Length=358
ATTAGGTTGGTGGTGGCGATGAATCTTATGGATTTCCAGAAATGATTGCTAATCATTCAA
ATCGAAAGCTTTTTATTCAGTCAGTGAAAAAAGCACTCGAGACATATTCACTTGATGGCA
TTGACATTGATTTTGAATTTCCTGATGGAAGTAATTCACAAAGAATTCATTTCATGCAAC
TTCTTCACGAAATTCGTCGCGAATACCAACGTGAGCACACAACTTACTTATTATCGATAG
CAGTTGCAGCACCTGCAGTATTTGTCGATATGTGTTATGATGTTCCGATGATTAACGAAA
ATGTGGATTATGTGAACATTATGACATACGATTATCACTTTTATTCCAAAGGAACTCC

>g10923.t6 Gene=g10923 Length=105
MIANHSNRKLFIQSVKKALETYSLDGIDIDFEFPDGSNSQRIHFMQLLHEIRREYQREHT
TYLLSIAVAAPAVFVDMCYDVPMINENVDYVNIMTYDYHFYSKGT

Protein features from InterProScan

Transcript Database ID Name Start End E.value
7 g10923.t6 Gene3D G3DSA:3.20.20.80 Glycosidases 1 105 1.5E-30
2 g10923.t6 PANTHER PTHR11177 CHITINASE 1 103 7.3E-34
3 g10923.t6 PANTHER PTHR11177:SF324 CHITINASE 11 1 103 7.3E-34
1 g10923.t6 Pfam PF00704 Glycosyl hydrolases family 18 2 99 3.7E-26
6 g10923.t6 ProSitePatterns PS01095 Chitinases family 18 active site. 24 32 -
5 g10923.t6 SUPERFAMILY SSF51445 (Trans)glycosidases 1 101 8.88E-30
4 g10923.t6 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 62 84 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds MF
GO:0005975 carbohydrate metabolic process BP

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed