General information for g10955.t6
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Ecdysone receptor.
Parent gene
- The parent gene g10955 is located on chr_1: 13001000..13004105 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10955 | g10955.t6 | TTS | g10955.t6 | 13000302 | 13000302 |
| chr_1 | g10955 | g10955.t6 | isoform | g10955.t6 | 13000537 | 13001000 |
| chr_1 | g10955 | g10955.t6 | exon | g10955.t6.exon1 | 13000537 | 13000820 |
| chr_1 | g10955 | g10955.t6 | cds | g10955.t6.CDS1 | 13000538 | 13000820 |
| chr_1 | g10955 | g10955.t6 | exon | g10955.t6.exon2 | 13000879 | 13001000 |
| chr_1 | g10955 | g10955.t6 | cds | g10955.t6.CDS2 | 13000879 | 13001000 |
| chr_1 | g10955 | g10955.t6 | TSS | g10955.t6 | 13001290 | 13001290 |
Sequences
>g10955.t6 Gene=g10955 Length=406
ATGAAGACAGAAAATCTAATTGTAACAACAGTAAAAGTTGAACCATTGAATTATGCTGCT
ACACAATCTTATGGTGAAAATAACATTTATGGCGGTGCAGCTAAGAAACAACGATTAGAA
AGTGATGAATGGATGAATCAATCAAATATGAATCTCGAATCTTCCAATATGAATCATAAC
ACAATTAGTGGCTTTTCATCGTCACCAGATAACTACGAGGCATATAGCCCAAATGGTAAA
ATGGGAATGGATGATAACAACATGAGCTCACATTTGAGTGATTGCCTCGACTCAAAAAAG
TCCAAAAAAGGACCCGTTCCAAGACAACAGGAAGAGTTGTGCCTCGTTTGTGGAGATCGT
GCCTCGGGATATCATTATAACGCGTTGACGTGTGAAGGGTGCAAAG
>g10955.t6 Gene=g10955 Length=135
MKTENLIVTTVKVEPLNYAATQSYGENNIYGGAAKKQRLESDEWMNQSNMNLESSNMNHN
TISGFSSSPDNYEAYSPNGKMGMDDNNMSSHLSDCLDSKKSKKGPVPRQQEELCLVCGDR
ASGYHYNALTCEGCK
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 8 | g10955.t6 | Gene3D | G3DSA:3.30.50.10 | - | 106 | 135 | 3.2E-9 |
| 7 | g10955.t6 | MobiDBLite | mobidb-lite | consensus disorder prediction | 83 | 105 | - |
| 2 | g10955.t6 | PANTHER | PTHR48092:SF9 | ECDYSONE RECEPTOR-LIKE PROTEIN | 27 | 135 | 3.5E-23 |
| 3 | g10955.t6 | PANTHER | PTHR48092 | KNIRPS-RELATED PROTEIN-RELATED | 27 | 135 | 3.5E-23 |
| 5 | g10955.t6 | PRINTS | PR00047 | C4-type steroid receptor zinc finger signature | 114 | 130 | 4.3E-7 |
| 4 | g10955.t6 | PRINTS | PR00047 | C4-type steroid receptor zinc finger signature | 130 | 135 | 4.3E-7 |
| 1 | g10955.t6 | Pfam | PF00105 | Zinc finger, C4 type (two domains) | 113 | 135 | 4.5E-9 |
| 9 | g10955.t6 | ProSiteProfiles | PS51030 | Nuclear hormone receptors DNA-binding domain profile. | 111 | 135 | 9.27 |
| 6 | g10955.t6 | SUPERFAMILY | SSF57716 | Glucocorticoid receptor-like (DNA-binding domain) | 112 | 135 | 1.12E-7 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0006355 | regulation of transcription, DNA-templated | BP |
| GO:0043565 | sequence-specific DNA binding | MF |
| GO:0008270 | zinc ion binding | MF |
| GO:0003700 | DNA-binding transcription factor activity | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed