| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g10976 | g10976.t8 | isoform | g10976.t8 | 13106923 | 13107425 |
| chr_1 | g10976 | g10976.t8 | TSS | g10976.t8 | 13106923 | 13106923 |
| chr_1 | g10976 | g10976.t8 | exon | g10976.t8.exon1 | 13106923 | 13107012 |
| chr_1 | g10976 | g10976.t8 | cds | g10976.t8.CDS1 | 13106924 | 13107012 |
| chr_1 | g10976 | g10976.t8 | exon | g10976.t8.exon2 | 13107065 | 13107264 |
| chr_1 | g10976 | g10976.t8 | cds | g10976.t8.CDS2 | 13107065 | 13107264 |
| chr_1 | g10976 | g10976.t8 | exon | g10976.t8.exon3 | 13107319 | 13107356 |
| chr_1 | g10976 | g10976.t8 | cds | g10976.t8.CDS3 | 13107319 | 13107356 |
| chr_1 | g10976 | g10976.t8 | exon | g10976.t8.exon4 | 13107420 | 13107425 |
| chr_1 | g10976 | g10976.t8 | cds | g10976.t8.CDS4 | 13107420 | 13107425 |
| chr_1 | g10976 | g10976.t8 | TTS | g10976.t8 | 13108157 | 13108157 |
>g10976.t8 Gene=g10976 Length=334
GGAAAATAATTTTGAGTTGATTATTCCATCTTATAAGTACAATTTTGGATCTCAAAATAA
AAATGTATTCAAAAATGAATATGGCACATGGACCATATATATTTTTTCATCGCACAATTG
CAGCCTTAATGGCATAGTAATTCTTGATCCAGTTTTTGATCAAAAAAGACTTGATTATAA
GCAAATTAAAATTGATGTTGAATGCATAAATCCAGATGGTCATAATTCTTTTGTTATTGC
TAAACATCTTGAGAAAGCTATTTTTACGTTTGGACCAACTGACAGTCAATTTAACTCAAC
TCAACTTTTTTATGAAATCACAGTCAAGATCACG
>g10976.t8 Gene=g10976 Length=111
ENNFELIIPSYKYNFGSQNKNVFKNEYGTWTIYIFSSHNCSLNGIVILDPVFDQKRLDYK
QIKIDVECINPDGHNSFVIAKHLEKAIFTFGPTDSQFNSTQLFYEITVKIT
No InterPro annotations for this transcript.
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed