Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g10976 g10976.t8 isoform g10976.t8 13106923 13107425
chr_1 g10976 g10976.t8 TSS g10976.t8 13106923 13106923
chr_1 g10976 g10976.t8 exon g10976.t8.exon1 13106923 13107012
chr_1 g10976 g10976.t8 cds g10976.t8.CDS1 13106924 13107012
chr_1 g10976 g10976.t8 exon g10976.t8.exon2 13107065 13107264
chr_1 g10976 g10976.t8 cds g10976.t8.CDS2 13107065 13107264
chr_1 g10976 g10976.t8 exon g10976.t8.exon3 13107319 13107356
chr_1 g10976 g10976.t8 cds g10976.t8.CDS3 13107319 13107356
chr_1 g10976 g10976.t8 exon g10976.t8.exon4 13107420 13107425
chr_1 g10976 g10976.t8 cds g10976.t8.CDS4 13107420 13107425
chr_1 g10976 g10976.t8 TTS g10976.t8 13108157 13108157

Sequences

>g10976.t8 Gene=g10976 Length=334
GGAAAATAATTTTGAGTTGATTATTCCATCTTATAAGTACAATTTTGGATCTCAAAATAA
AAATGTATTCAAAAATGAATATGGCACATGGACCATATATATTTTTTCATCGCACAATTG
CAGCCTTAATGGCATAGTAATTCTTGATCCAGTTTTTGATCAAAAAAGACTTGATTATAA
GCAAATTAAAATTGATGTTGAATGCATAAATCCAGATGGTCATAATTCTTTTGTTATTGC
TAAACATCTTGAGAAAGCTATTTTTACGTTTGGACCAACTGACAGTCAATTTAACTCAAC
TCAACTTTTTTATGAAATCACAGTCAAGATCACG

>g10976.t8 Gene=g10976 Length=111
ENNFELIIPSYKYNFGSQNKNVFKNEYGTWTIYIFSSHNCSLNGIVILDPVFDQKRLDYK
QIKIDVECINPDGHNSFVIAKHLEKAIFTFGPTDSQFNSTQLFYEITVKIT

Protein features from InterProScan

No InterPro annotations for this transcript.

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed