| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11017 | g11017.t22 | TTS | g11017.t22 | 13420777 | 13420777 |
| chr_1 | g11017 | g11017.t22 | isoform | g11017.t22 | 13420889 | 13421756 |
| chr_1 | g11017 | g11017.t22 | exon | g11017.t22.exon1 | 13420889 | 13420964 |
| chr_1 | g11017 | g11017.t22 | cds | g11017.t22.CDS1 | 13420889 | 13420964 |
| chr_1 | g11017 | g11017.t22 | exon | g11017.t22.exon2 | 13421061 | 13421368 |
| chr_1 | g11017 | g11017.t22 | cds | g11017.t22.CDS2 | 13421061 | 13421368 |
| chr_1 | g11017 | g11017.t22 | exon | g11017.t22.exon3 | 13421542 | 13421628 |
| chr_1 | g11017 | g11017.t22 | cds | g11017.t22.CDS3 | 13421542 | 13421628 |
| chr_1 | g11017 | g11017.t22 | exon | g11017.t22.exon4 | 13421754 | 13421756 |
| chr_1 | g11017 | g11017.t22 | cds | g11017.t22.CDS4 | 13421754 | 13421756 |
| chr_1 | g11017 | g11017.t22 | TSS | g11017.t22 | 13421778 | 13421778 |
>g11017.t22 Gene=g11017 Length=474
ATGGGCAAGGACATTAGTCATAAGTGGGACAGAAAAGTCCGCAGAACATCTCCAAAATCA
TTGGATGTTTACTTGCGTCTTTTAGTGAAGCTTTATCGCTTCCTGTATCGCAGAACTCAT
CAGAAGTTCAATAAAATCATTCTGCGACGTTTATTCATGAGTAAAATCAACCGCCCAGTG
ATTTCGTTGCAACGCGTAATCCGTTTGATGAAACAACGTCAAGCAAAGGAAAACACAATT
GCAGTTATTGTTGGCAAAGTTACAAATGACTTGAGAATTTTGGAAGTACCAAAATTGCGC
ATCTGTGCATTAAGAGTTAGTGAACGTGCCCGTGAGCGCATTATTAAGAGTGGCGGTGAA
GTTTTAACTTTCGATCAATTGGCATTGCTCGCACCTACACCATACGTTCGATCAAAAGGA
CGTAAATTCGAACGCGCTCGTGGTCGCAGAACATCATGCGGATACAAGAAGTAA
>g11017.t22 Gene=g11017 Length=157
MGKDISHKWDRKVRRTSPKSLDVYLRLLVKLYRFLYRRTHQKFNKIILRRLFMSKINRPV
ISLQRVIRLMKQRQAKENTIAVIVGKVTNDLRILEVPKLRICALRVSERARERIIKSGGE
VLTFDQLALLAPTPYVRSKGRKFERARGRRTSCGYKK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g11017.t22 | Gene3D | G3DSA:3.100.10.10 | - | 1 | 132 | 7.8E-58 |
| 8 | g11017.t22 | Gene3D | G3DSA:3.100.10.10 | - | 133 | 157 | 2.1E-5 |
| 3 | g11017.t22 | PANTHER | PTHR10934 | 60S RIBOSOMAL PROTEIN L18 | 1 | 133 | 3.7E-58 |
| 5 | g11017.t22 | PANTHER | PTHR10934:SF2 | 60S RIBOSOMAL PROTEIN L18 | 1 | 133 | 3.7E-58 |
| 2 | g11017.t22 | PANTHER | PTHR10934 | 60S RIBOSOMAL PROTEIN L18 | 133 | 156 | 3.7E-58 |
| 4 | g11017.t22 | PANTHER | PTHR10934:SF2 | 60S RIBOSOMAL PROTEIN L18 | 133 | 156 | 3.7E-58 |
| 1 | g11017.t22 | Pfam | PF17135 | Ribosomal protein 60S L18 and 50S L18e | 2 | 133 | 6.9E-59 |
| 7 | g11017.t22 | ProSitePatterns | PS01106 | Ribosomal protein L18e signature. | 49 | 66 | - |
| 6 | g11017.t22 | SUPERFAMILY | SSF52080 | Ribosomal proteins L15p and L18e | 22 | 133 | 1.2E-23 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed