| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11123 | g11123.t12 | TSS | g11123.t12 | 14279758 | 14279758 |
| chr_1 | g11123 | g11123.t12 | isoform | g11123.t12 | 14280770 | 14281356 |
| chr_1 | g11123 | g11123.t12 | exon | g11123.t12.exon1 | 14280770 | 14280873 |
| chr_1 | g11123 | g11123.t12 | cds | g11123.t12.CDS1 | 14280821 | 14280873 |
| chr_1 | g11123 | g11123.t12 | exon | g11123.t12.exon2 | 14280930 | 14281093 |
| chr_1 | g11123 | g11123.t12 | cds | g11123.t12.CDS2 | 14280930 | 14281093 |
| chr_1 | g11123 | g11123.t12 | exon | g11123.t12.exon3 | 14281168 | 14281264 |
| chr_1 | g11123 | g11123.t12 | cds | g11123.t12.CDS3 | 14281168 | 14281264 |
| chr_1 | g11123 | g11123.t12 | exon | g11123.t12.exon4 | 14281326 | 14281356 |
| chr_1 | g11123 | g11123.t12 | cds | g11123.t12.CDS4 | 14281326 | 14281356 |
| chr_1 | g11123 | g11123.t12 | TTS | g11123.t12 | 14282289 | 14282289 |
>g11123.t12 Gene=g11123 Length=396
GGACAATCAAGTCTTGCTTTCGGTTTGATTCTTCTATTTATTATAGTCTCAATGTTGTCA
ACGTTTTTCCAATCTGATCCGATGTATAGCTTATCGCCTAGCTCAAAATATCCTCTTGAA
CGAAAGACAATTAATCATCGCATTCCTTACTACGTAAAAGAAAATTTTGGATCCGAATAT
CAAGGATCTATGAGTCGGCTTGAGAGTGCTGTCGAGGAAGAATATATAATGAATATGAAA
AGAGCATGCTTTAGTGAGAAAAATTATCGTGAGGCAATGATGTCAAGGGCACGAAGCTTC
GGTAGTAGAACACAATATGCTCAGGCTCAAGCATTAAAGACGCCTTCTTGTGATGCACTC
TATCGACTGGGTATATCAGGACGAACATCATATTAA
>g11123.t12 Gene=g11123 Length=114
MLSTFFQSDPMYSLSPSSKYPLERKTINHRIPYYVKENFGSEYQGSMSRLESAVEEEYIM
NMKRACFSEKNYREAMMSRARSFGSRTQYAQAQALKTPSCDALYRLGISGRTSY
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g11123.t12 | PANTHER | PTHR43908 | AT29763P-RELATED | 2 | 104 | 0 |
| 3 | g11123.t12 | PANTHER | PTHR43908:SF8 | DNAJ HOMOLOG SUBFAMILY B MEMBER 12 | 2 | 104 | 0 |
| 1 | g11123.t12 | Pfam | PF09320 | Domain of unknown function (DUF1977) | 7 | 104 | 0 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.