| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11123 | g11123.t2 | TSS | g11123.t2 | 14279758 | 14279758 |
| chr_1 | g11123 | g11123.t2 | isoform | g11123.t2 | 14279816 | 14280143 |
| chr_1 | g11123 | g11123.t2 | exon | g11123.t2.exon1 | 14279816 | 14280143 |
| chr_1 | g11123 | g11123.t2 | cds | g11123.t2.CDS1 | 14279816 | 14280142 |
| chr_1 | g11123 | g11123.t2 | TTS | g11123.t2 | NA | NA |
>g11123.t2 Gene=g11123 Length=328
ATGACGATAATTGAGGGAAATATAGATGCAAGTGAGCAATGTGTTGATTTAGCAAGTAAA
GAAATATCAAATGGAAACTTAGAAAAAGCAGAAAAACTGCTTTTAAAGGCGCTAAAATTA
TATCCAACAAATCGCAAGGCAGAGTTAATTTTAGAGAAATTAAAAGCTGGACGATTCAAC
ACTAAAACATCAAATGGTAGTACTACAACTGGCAACAACGATGGAATTCATCAAAGAAGA
CGGCCAACTACTGCACCAAAAGCAGATGAGCCTAAATTAGGTGAAGATTACACTCAAGAG
CAATTGGAGATTGTTCAGAAAATTAAAA
>g11123.t2 Gene=g11123 Length=109
MTIIEGNIDASEQCVDLASKEISNGNLEKAEKLLLKALKLYPTNRKAELILEKLKAGRFN
TKTSNGSTTTGNNDGIHQRRRPTTAPKADEPKLGEDYTQEQLEIVQKIK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 2 | g11123.t2 | MobiDBLite | mobidb-lite | consensus disorder prediction | 60 | 99 | - |
| 3 | g11123.t2 | MobiDBLite | mobidb-lite | consensus disorder prediction | 60 | 79 | - |
| 1 | g11123.t2 | MobiDBLite | mobidb-lite | consensus disorder prediction | 80 | 97 | - |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.