Gene loci information

Transcript annotation

  • This transcript has been annotated as Allatostatin-A receptor.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g11147 g11147.t1 isoform g11147.t1 14326492 14327681
chr_1 g11147 g11147.t1 exon g11147.t1.exon1 14326492 14326569
chr_1 g11147 g11147.t1 cds g11147.t1.CDS1 14326492 14326569
chr_1 g11147 g11147.t1 exon g11147.t1.exon2 14326681 14327358
chr_1 g11147 g11147.t1 cds g11147.t1.CDS2 14326681 14327358
chr_1 g11147 g11147.t1 exon g11147.t1.exon3 14327427 14327681
chr_1 g11147 g11147.t1 cds g11147.t1.CDS3 14327427 14327681
chr_1 g11147 g11147.t1 TSS g11147.t1 NA NA
chr_1 g11147 g11147.t1 TTS g11147.t1 NA NA

Sequences

>g11147.t1 Gene=g11147 Length=1011
ATGAGTGAATCGCAATTTCCTGCATCTCATACGCCAAGCCCAGAAGAGCAAGATGCTGAT
GCTCGATTAGAATTAATTGTGTCAATAGTTGTACCAATATTTTTCAGTCTTATTGGATTG
ACAGGATTTATTGGCAATCTTCTTGTAATTATAACTGTTATATTCAATCAACAAATGCGA
AATACAACAAATTTACTCATTTTCAATTTATCTTTTGCCGATCTGCTTTTTATTTGCTTT
TGTATCCCATTTACTGGAGTGGATTATTCATTGAGTTGGTGGCCATTTGGCGAGTTCTGG
TGTAAAACTGTGCAATTTTTAATATTTTGCACAGCATATATATCAATATATACCCTTGTG
CTAATGTCACTTGATCGCTATTTAGCAGTGTGTTTTCCTGTGAGTCGTGTTAGAAATGAA
CGAAATACAATTATATCAATTTTTGCACTATGGTTTATTGTATTACTGACTAATTTGCCA
GTATTTCATGCACATGGAATTAATGAATATGTTTACAATGATAGAAATTTAACCAGCTGT
ACTTTTCTCGATGACAACGAATTGATTTCATGGAGTACTTTTCACGTGTCATTTTTTACA
AGCAGTTACCTCATGCCCTTACTTTTCATATCAATTTTATATTTTCTGATGCTTCTTCGT
CTTTGGAAAAGCAATTTAACACAATCATCCGAATCGAAACGGGGAAAAAGAAGAGTAACG
AGACTTGTTCTTGTTATAGTTGCATGCTTTGCAATACTTTGGCTGCCAATTCAATCTATA
TTACTTTTAAAAAGTCTCAAAATGTATGAAGCGACAACGCACTTGACTATTGCATTACAA
ATAAGTGCCCATATACTCGCCTATGCATCGAGTTGTATTAATCCGCTGTTGTACGCTTTT
CTTAGTGAGAATTTTCGCAAAAGTTTCCGAAAGATAATTTATTGCCATCCATCGAGTAAT
TCACGGTACTTTCCAACAGCCACAAAATTCACAGCAACAACTGGTACATGA

>g11147.t1 Gene=g11147 Length=336
MSESQFPASHTPSPEEQDADARLELIVSIVVPIFFSLIGLTGFIGNLLVIITVIFNQQMR
NTTNLLIFNLSFADLLFICFCIPFTGVDYSLSWWPFGEFWCKTVQFLIFCTAYISIYTLV
LMSLDRYLAVCFPVSRVRNERNTIISIFALWFIVLLTNLPVFHAHGINEYVYNDRNLTSC
TFLDDNELISWSTFHVSFFTSSYLMPLLFISILYFLMLLRLWKSNLTQSSESKRGKRRVT
RLVLVIVACFAILWLPIQSILLLKSLKMYEATTHLTIALQISAHILAYASSCINPLLYAF
LSENFRKSFRKIIYCHPSSNSRYFPTATKFTATTGT

Protein features from InterProScan

Transcript Database ID Name Start End E.value
32 g11147.t1 CDD cd15096 7tmA_AstA_R_insect 29 309 1.57512E-116
16 g11147.t1 Gene3D G3DSA:1.20.1070.10 - 3 334 1.5E-82
2 g11147.t1 PANTHER PTHR45695 LEUCOKININ RECEPTOR-RELATED 20 314 2.5E-71
6 g11147.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 30 54 6.2E-44
5 g11147.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 63 84 6.2E-44
14 g11147.t1 PRINTS PR00663 Galanin receptor signature 77 91 1.1E-9
12 g11147.t1 PRINTS PR00663 Galanin receptor signature 94 112 1.1E-9
9 g11147.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 108 130 6.2E-44
11 g11147.t1 PRINTS PR00663 Galanin receptor signature 134 150 1.1E-9
4 g11147.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 142 163 6.2E-44
10 g11147.t1 PRINTS PR00663 Galanin receptor signature 190 205 1.1E-9
8 g11147.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 195 218 6.2E-44
7 g11147.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 239 263 6.2E-44
13 g11147.t1 PRINTS PR00663 Galanin receptor signature 267 287 1.1E-9
3 g11147.t1 PRINTS PR00237 Rhodopsin-like GPCR superfamily signature 280 306 6.2E-44
1 g11147.t1 Pfam PF00001 7 transmembrane receptor (rhodopsin family) 45 298 6.7E-51
23 g11147.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 1 24 -
26 g11147.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 25 54 -
17 g11147.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 55 65 -
29 g11147.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 66 86 -
22 g11147.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 87 105 -
28 g11147.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 106 124 -
18 g11147.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 125 143 -
27 g11147.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 144 162 -
21 g11147.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 163 202 -
30 g11147.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 203 222 -
20 g11147.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 223 241 -
25 g11147.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 242 261 -
24 g11147.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 262 280 -
31 g11147.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 281 301 -
19 g11147.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 302 336 -
41 g11147.t1 ProSitePatterns PS00237 G-protein coupled receptors family 1 signature. 114 130 -
42 g11147.t1 ProSiteProfiles PS50262 G-protein coupled receptors family 1 profile. 45 298 45.307
40 g11147.t1 SMART SM01381 7TM_GPCR_Srsx_2 42 313 0.0031
15 g11147.t1 SUPERFAMILY SSF81321 Family A G protein-coupled receptor-like 26 321 3.2E-70
39 g11147.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 30 52 -
34 g11147.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 65 87 -
36 g11147.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 102 124 -
33 g11147.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 145 167 -
35 g11147.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 196 218 -
37 g11147.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 239 261 -
38 g11147.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 276 298 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0007186 G protein-coupled receptor signaling pathway BP
GO:0016021 integral component of membrane CC
GO:0004930 G protein-coupled receptor activity MF

KEGG

Orthology

Pathway

  • This transcript belongs to the following pathways

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed