Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g11204 g11204.t9 isoform g11204.t9 14563947 14565367
chr_1 g11204 g11204.t9 exon g11204.t9.exon1 14563947 14564106
chr_1 g11204 g11204.t9 cds g11204.t9.CDS1 14563948 14564106
chr_1 g11204 g11204.t9 exon g11204.t9.exon2 14564189 14564325
chr_1 g11204 g11204.t9 cds g11204.t9.CDS2 14564189 14564325
chr_1 g11204 g11204.t9 exon g11204.t9.exon3 14564419 14564564
chr_1 g11204 g11204.t9 cds g11204.t9.CDS3 14564419 14564564
chr_1 g11204 g11204.t9 exon g11204.t9.exon4 14565336 14565367
chr_1 g11204 g11204.t9 cds g11204.t9.CDS4 14565336 14565367
chr_1 g11204 g11204.t9 TSS g11204.t9 14565619 14565619
chr_1 g11204 g11204.t9 TTS g11204.t9 NA NA

Sequences

>g11204.t9 Gene=g11204 Length=475
ATGGCGGTATATTTCATTCCCAAAACAAAATTGATCTCAAGAGCGACAAACAATTTTCGA
CCAAAACAGTGGACGTCGAAATGGACGATAATTAGAAGGCCGTTTTCACAGTCACAACAA
CAATATCACCAACAGAATAGCAATAGTACAAATGCTAAAAATCAAAATACCCGCAAAGGA
GGATGGCTATCATGGCAAGGCGCAATCTTGCGTTGGACTCCGTTGGGTATATGTATAATC
GCTGCTGCACATTGGCATCTGCATAAACGTGAATGCGAAAGAAGAGGTCTTCCAAAAACA
GCCACTGCATGGCAGACAAATGTATATTGTTCGCTTCCGTTGAGACTCATGAGTAGATGT
TGGGGTTGGCTTGCAGACCGAGAAGTGCCTGAAATTCTTCGACCGTCCATATTTGGAATT
TATTCGTCATCATTTGGTGTTAATCTTGAAGAGGCTGTTGTATCAGATTTAAAGT

>g11204.t9 Gene=g11204 Length=158
MAVYFIPKTKLISRATNNFRPKQWTSKWTIIRRPFSQSQQQYHQQNSNSTNAKNQNTRKG
GWLSWQGAILRWTPLGICIIAAAHWHLHKRECERRGLPKTATAWQTNVYCSLPLRLMSRC
WGWLADREVPEILRPSIFGIYSSSFGVNLEEAVVSDLK

Protein features from InterProScan

Transcript Database ID Name Start End E.value
2 g11204.t9 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 1 68 -
3 g11204.t9 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 69 87 -
1 g11204.t9 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 88 158 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.

Raw TPM values