Gene loci information

Transcript annotation

  • This transcript has been annotated as hypothetical.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g11236 g11236.t8 isoform g11236.t8 14845992 14846360
chr_1 g11236 g11236.t8 exon g11236.t8.exon1 14845992 14846038
chr_1 g11236 g11236.t8 exon g11236.t8.exon2 14846104 14846360
chr_1 g11236 g11236.t8 cds g11236.t8.CDS1 14846175 14846360
chr_1 g11236 g11236.t8 TTS g11236.t8 14847140 14847140
chr_1 g11236 g11236.t8 TSS g11236.t8 NA NA

Sequences

>g11236.t8 Gene=g11236 Length=304
GCTTCAAGAAATTGACTCTAATTGTGAAGTTGTAAATAAAGTGCTTGTTGGAAACAAAAA
TGATGATCCGCAGAGGAAGGTTGTTCTAACCGAAGACGCACAACGATTTGCCGAGCAAAT
GGGAATACCATTATATGAGACATCCGCCAAAGATAATTTGAATGTAGAAGAAATGTTCTT
AGCAATAACGGAAAAAGTTCTGCGTCATAAAAAACAGACTCAGCGTCAACAGAATGATCA
GAACGATGATCGAATTAAAATAAATAATACAAGTGGCATTAAGAAGAAGAAAAAATGTTG
CTAG

>g11236.t8 Gene=g11236 Length=61
MGIPLYETSAKDNLNVEEMFLAITEKVLRHKKQTQRQQNDQNDDRIKINNTSGIKKKKKC
C

Protein features from InterProScan

Transcript Database ID Name Start End E.value
5 g11236.t8 Gene3D G3DSA:3.40.50.300 - 1 61 2.9E-10
4 g11236.t8 MobiDBLite mobidb-lite consensus disorder prediction 30 61 -
1 g11236.t8 PANTHER PTHR47977 LD21953P-RELATED 1 61 3.3E-12
2 g11236.t8 PANTHER PTHR47977:SF29 RAS-RELATED PROTEIN RAB-35 1 61 3.3E-12
6 g11236.t8 ProSiteProfiles PS51419 small GTPase Rab1 family profile. 1 61 8.823
3 g11236.t8 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases 2 49 8.8E-7

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed