Gene loci information

Transcript annotation

  • This transcript has been annotated as Putative Chymotrypsin-1.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g11269 g11269.t2 TSS g11269.t2 15274498 15274498
chr_1 g11269 g11269.t2 isoform g11269.t2 15274515 15275748
chr_1 g11269 g11269.t2 exon g11269.t2.exon1 15274515 15274569
chr_1 g11269 g11269.t2 cds g11269.t2.CDS1 15274515 15274569
chr_1 g11269 g11269.t2 exon g11269.t2.exon2 15274626 15274667
chr_1 g11269 g11269.t2 cds g11269.t2.CDS2 15274626 15274667
chr_1 g11269 g11269.t2 exon g11269.t2.exon3 15275270 15275380
chr_1 g11269 g11269.t2 cds g11269.t2.CDS3 15275270 15275380
chr_1 g11269 g11269.t2 exon g11269.t2.exon4 15275451 15275595
chr_1 g11269 g11269.t2 cds g11269.t2.CDS4 15275451 15275595
chr_1 g11269 g11269.t2 exon g11269.t2.exon5 15275672 15275748
chr_1 g11269 g11269.t2 cds g11269.t2.CDS5 15275672 15275747
chr_1 g11269 g11269.t2 TTS g11269.t2 NA NA

Sequences

>g11269.t2 Gene=g11269 Length=430
ATGATTCGTCAAGTATTTTTATTAGTGACATTGGCAGTTGCTGCCTTTGCAGGACCCCTT
TCTGATAGATTCTTGAATGGAAGAATTGTTGGTGGTGCTCCAGCAGTTGATGGACAATTC
CCATATCAAGTTTCTCTTCGTACATTCCCTGCACTGGGACATTTCTGTGGTGGATCAATT
ATTCAAGAACATTGGGTTCTTTCAGCAGCTCATTGCACAATCAACCGCACACCTGCCAAT
ACCCGTGTCGTTGCTGGTACAGTTCTTCTTAATGGTGGCGCAAATCCTCAACTTCATGAT
GTCGAGAGAATTGTCAATCATCCAAACTACGATTCAGCCTTAATTGCTCAAGACGTTTGC
GTCATTCGAGTGACAAGTCCGTTCATATTCACGGCAAATGTTCGTGCTATTCCTTATGCC
AGTCACTTTA

>g11269.t2 Gene=g11269 Length=143
MIRQVFLLVTLAVAAFAGPLSDRFLNGRIVGGAPAVDGQFPYQVSLRTFPALGHFCGGSI
IQEHWVLSAAHCTINRTPANTRVVAGTVLLNGGANPQLHDVERIVNHPNYDSALIAQDVC
VIRVTSPFIFTANVRAIPYASHF

Protein features from InterProScan

Transcript Database ID Name Start End E.value
13 g11269.t2 CDD cd00190 Tryp_SPc 29 138 1.18463E-37
7 g11269.t2 Gene3D G3DSA:2.40.10.10 - 22 142 4.2E-29
2 g11269.t2 PANTHER PTHR24250 CHYMOTRYPSIN-RELATED 20 137 1.1E-26
4 g11269.t2 PRINTS PR00722 Chymotrypsin serine protease family (S1) signature 57 72 1.0E-5
3 g11269.t2 PRINTS PR00722 Chymotrypsin serine protease family (S1) signature 114 128 1.0E-5
1 g11269.t2 Pfam PF00089 Trypsin 29 141 6.5E-25
9 g11269.t2 Phobius SIGNAL_PEPTIDE Signal peptide region 1 17 -
10 g11269.t2 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide. 1 4 -
11 g11269.t2 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide. 5 13 -
12 g11269.t2 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide. 14 17 -
8 g11269.t2 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 18 143 -
15 g11269.t2 ProSitePatterns PS00134 Serine proteases, trypsin family, histidine active site. 67 72 -
16 g11269.t2 ProSiteProfiles PS50240 Serine proteases, trypsin domain profile. 29 143 14.158
14 g11269.t2 SMART SM00020 trypsin_2 28 142 6.1E-4
5 g11269.t2 SUPERFAMILY SSF50494 Trypsin-like serine proteases 5 141 6.78E-36
6 g11269.t2 SignalP_EUK SignalP-noTM SignalP-noTM 1 17 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

GOID TERM ONTOLOGY
GO:0004252 serine-type endopeptidase activity MF
GO:0006508 proteolysis BP

KEGG

Orthology

This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed