General information for g11302.t10
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative 40S ribosomal protein S25.
Parent gene
- The parent gene g11302 is located on chr_1: 15497275..15505521 (- strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11302 | g11302.t10 | TTS | g11302.t10 | 15497036 | 15497036 |
| chr_1 | g11302 | g11302.t10 | isoform | g11302.t10 | 15497135 | 15497973 |
| chr_1 | g11302 | g11302.t10 | exon | g11302.t10.exon1 | 15497135 | 15497216 |
| chr_1 | g11302 | g11302.t10 | cds | g11302.t10.CDS1 | 15497209 | 15497216 |
| chr_1 | g11302 | g11302.t10 | exon | g11302.t10.exon2 | 15497276 | 15497552 |
| chr_1 | g11302 | g11302.t10 | cds | g11302.t10.CDS2 | 15497276 | 15497552 |
| chr_1 | g11302 | g11302.t10 | exon | g11302.t10.exon3 | 15497949 | 15497973 |
| chr_1 | g11302 | g11302.t10 | cds | g11302.t10.CDS3 | 15497949 | 15497951 |
| chr_1 | g11302 | g11302.t10 | TSS | g11302.t10 | 15497973 | 15497973 |
Sequences
>g11302.t10 Gene=g11302 Length=384
CTTTTCTGAACGTTCAGTGAAAATGCCTCCAAAAAAGGACACTAAAGGATCGGCCAAGCA
GCCACAAAAGACACAAAAGAAGAAGGAAGGAGGAGGAGGTGGCAAAGCAAAAAAGAAGAA
GTGGTCGAAAGGAAAAGTTCGTGATAAGTTAAACAATCAGGTTCTTTTCGACAAAGCCAC
TTACGAGAAATTGTATAAGGAAGTCCCTCAATACAAGCTCATTACTCCATCGGTAGTGTC
TGAAAGATTGAAGGTTCGTGGTTCATTAGCTAAGAGAGCCCTCATTGAATTGCGCGACAA
AGAGGATTAATTAAGCAAGTTGTACACCATAATGCACAATTAATCTTCACGAGAACAACC
AAGGGCGATGATCCAGTTGCATAA
>g11302.t10 Gene=g11302 Length=95
MPPKKDTKGSAKQPQKTQKKKEGGGGGKAKKKKWSKGKVRDKLNNQVLFDKATYEKLYKE
VPQYKLITPSVVSERLKVRGSLAKRALIELRDKED
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g11302.t10 | Gene3D | G3DSA:1.10.10.2780 | - | 27 | 95 | 2.6E-30 |
| 4 | g11302.t10 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 42 | - |
| 5 | g11302.t10 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 24 | - |
| 2 | g11302.t10 | PANTHER | PTHR12850 | 40S RIBOSOMAL PROTEIN S25 | 1 | 93 | 1.2E-33 |
| 3 | g11302.t10 | PANTHER | PTHR12850:SF19 | - | 1 | 93 | 1.2E-33 |
| 1 | g11302.t10 | Pfam | PF03297 | S25 ribosomal protein | 12 | 94 | 1.4E-34 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
