| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11302 | g11302.t7 | TTS | g11302.t7 | 15497036 | 15497036 |
| chr_1 | g11302 | g11302.t7 | isoform | g11302.t7 | 15497135 | 15497951 |
| chr_1 | g11302 | g11302.t7 | exon | g11302.t7.exon1 | 15497135 | 15497214 |
| chr_1 | g11302 | g11302.t7 | cds | g11302.t7.CDS1 | 15497135 | 15497214 |
| chr_1 | g11302 | g11302.t7 | exon | g11302.t7.exon2 | 15497276 | 15497552 |
| chr_1 | g11302 | g11302.t7 | cds | g11302.t7.CDS2 | 15497276 | 15497552 |
| chr_1 | g11302 | g11302.t7 | exon | g11302.t7.exon3 | 15497945 | 15497951 |
| chr_1 | g11302 | g11302.t7 | cds | g11302.t7.CDS3 | 15497945 | 15497950 |
| chr_1 | g11302 | g11302.t7 | TSS | g11302.t7 | 15497973 | 15497973 |
>g11302.t7 Gene=g11302 Length=364
ATGGTTACCTCCAAAAAAGGACACTAAAGGATCGGCCAAGCAGCCACAAAAGACACAAAA
GAAGAAGGAAGGAGGAGGAGGTGGCAAAGCAAAAAAGAAGAAGTGGTCGAAAGGAAAAGT
TCGTGATAAGTTAAACAATCAGGTTCTTTTCGACAAAGCCACTTACGAGAAATTGTATAA
GGAAGTCCCTCAATACAAGCTCATTACTCCATCGGTAGTGTCTGAAAGATTGAAGGTTCG
TGGTTCATTAGCTAAGAGAGCCCTCATTGAATTGCGCGACAAAGGATTAATTAAGCAAGT
TGTACACCATAATGCACAATTAATCTTCACGAGAACAACCAAGGGCGATGATCCAGTTGC
ATAA
>g11302.t7 Gene=g11302 Length=120
WLPPKKDTKGSAKQPQKTQKKKEGGGGGKAKKKKWSKGKVRDKLNNQVLFDKATYEKLYK
EVPQYKLITPSVVSERLKVRGSLAKRALIELRDKGLIKQVVHHNAQLIFTRTTKGDDPVA
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 6 | g11302.t7 | Gene3D | G3DSA:1.10.10.2780 | - | 28 | 118 | 2.0E-39 |
| 5 | g11302.t7 | MobiDBLite | mobidb-lite | consensus disorder prediction | 1 | 40 | - |
| 4 | g11302.t7 | MobiDBLite | mobidb-lite | consensus disorder prediction | 10 | 25 | - |
| 2 | g11302.t7 | PANTHER | PTHR12850 | 40S RIBOSOMAL PROTEIN S25 | 3 | 118 | 6.8E-44 |
| 3 | g11302.t7 | PANTHER | PTHR12850:SF19 | - | 3 | 118 | 6.8E-44 |
| 1 | g11302.t7 | Pfam | PF03297 | S25 ribosomal protein | 13 | 111 | 1.8E-43 |
IUPRED3 score over 0.5 is predictive of a disordered region.
There are no GO annotations for this transcript.
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.