General information for g11305.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Ubiquitin-conjugating enzyme E2 J2.
Parent gene
- The parent gene g11305 is located on chr_1: 15507731..15527410 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11305 | g11305.t1 | TSS | g11305.t1 | 15506414 | 15506414 |
| chr_1 | g11305 | g11305.t1 | isoform | g11305.t1 | 15506516 | 15507731 |
| chr_1 | g11305 | g11305.t1 | exon | g11305.t1.exon1 | 15506516 | 15506562 |
| chr_1 | g11305 | g11305.t1 | cds | g11305.t1.CDS1 | 15506516 | 15506562 |
| chr_1 | g11305 | g11305.t1 | exon | g11305.t1.exon2 | 15506726 | 15506829 |
| chr_1 | g11305 | g11305.t1 | cds | g11305.t1.CDS2 | 15506726 | 15506829 |
| chr_1 | g11305 | g11305.t1 | exon | g11305.t1.exon3 | 15507193 | 15507731 |
| chr_1 | g11305 | g11305.t1 | cds | g11305.t1.CDS3 | 15507193 | 15507731 |
| chr_1 | g11305 | g11305.t1 | TTS | g11305.t1 | 15508068 | 15508068 |
Sequences
>g11305.t1 Gene=g11305 Length=690
ATGTCACAAAAATCATATACTGCTAGATTAAAACAGGATTATATGAGACTAAAATCGGAT
CCTGTACCTTTCATCAACGCAGAATTTTTGCCTTCAAACATATTGGAGTGGCATTATGTG
ATTCAAGGGCCTGTGGACAGCCCATACAGCGGTGGTTATTACCATGGCTCACTGATTTTT
AGTAAAGAATATCCATTTAAGCCACCTAGTATTTATATATTCACACCCAATGGACGTTTC
AAGCCTAACAAAAGACTATGTCTATCAATCAGTGATTATCATCCAGACACTTGGAATCCT
GCTTGGTCTGTTTCAACAATTCTCACAGGACTATTAAGTATCATGCTAGAAAATACACCT
CTCTTGGGAAGCTGTGAATCAACGACATATGAAAAGAAAAAATTAGCAATTAATTCACTT
GAGTTTAATCTAAAAAATGAAACTTTCAATGAGCTCTTTCCCGATTTAGTTACTGAAATC
AAAGCAAAGCTTGAAAAAATCAATGAAATAAAAAAGCAAAACGAGAAGGAAGCAACTGAA
AAAACTGCTAACGAAGTTAATCAACTTGATAGCAGCAGCAATAATGGAACGTTCAACTTT
TGCTTCAATGTGATAATTCTGGTTATATTTGGTGTTTTCGTATGTGTAGTACGAAAAGTT
CTTTACGAATCCGGTGATCAAGAAGAATAA
>g11305.t1 Gene=g11305 Length=229
MSQKSYTARLKQDYMRLKSDPVPFINAEFLPSNILEWHYVIQGPVDSPYSGGYYHGSLIF
SKEYPFKPPSIYIFTPNGRFKPNKRLCLSISDYHPDTWNPAWSVSTILTGLLSIMLENTP
LLGSCESTTYEKKKLAINSLEFNLKNETFNELFPDLVTEIKAKLEKINEIKKQNEKEATE
KTANEVNQLDSSSNNGTFNFCFNVIILVIFGVFVCVVRKVLYESGDQEE
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g11305.t1 | CDD | cd00195 | UBCc | 9 | 117 | 5.07822E-43 |
| 6 | g11305.t1 | Coils | Coil | Coil | 157 | 181 | - |
| 5 | g11305.t1 | Gene3D | G3DSA:3.10.110.10 | Ubiquitin Conjugating Enzyme | 1 | 181 | 1.5E-68 |
| 2 | g11305.t1 | PANTHER | PTHR24067 | UBIQUITIN-CONJUGATING ENZYME E2 | 3 | 193 | 2.0E-66 |
| 3 | g11305.t1 | PANTHER | PTHR24067:SF257 | UBIQUITIN CONJUGATING ENZYME | 3 | 193 | 2.0E-66 |
| 1 | g11305.t1 | Pfam | PF00179 | Ubiquitin-conjugating enzyme | 9 | 119 | 1.8E-18 |
| 8 | g11305.t1 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. | 1 | 196 | - |
| 9 | g11305.t1 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. | 197 | 217 | - |
| 7 | g11305.t1 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. | 218 | 229 | - |
| 13 | g11305.t1 | ProSiteProfiles | PS50127 | Ubiquitin-conjugating enzymes family profile. | 8 | 120 | 21.598 |
| 12 | g11305.t1 | SMART | SM00212 | ubc_7 | 8 | 162 | 4.9E-30 |
| 4 | g11305.t1 | SUPERFAMILY | SSF54495 | UBC-like | 6 | 155 | 1.16E-38 |
| 11 | g11305.t1 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. | 200 | 222 | - |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
There are no GO annotations for this transcript.
KEGG
Orthology
- This transcript has been annotated with K04554 (ubiquitin-conjugating enzyme E2 J2)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
