| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11383 | g11383.t7 | TTS | g11383.t7 | 15878931 | 15878931 |
| chr_1 | g11383 | g11383.t7 | isoform | g11383.t7 | 15879154 | 15879709 |
| chr_1 | g11383 | g11383.t7 | exon | g11383.t7.exon1 | 15879154 | 15879261 |
| chr_1 | g11383 | g11383.t7 | cds | g11383.t7.CDS1 | 15879154 | 15879261 |
| chr_1 | g11383 | g11383.t7 | exon | g11383.t7.exon2 | 15879344 | 15879465 |
| chr_1 | g11383 | g11383.t7 | cds | g11383.t7.CDS2 | 15879344 | 15879465 |
| chr_1 | g11383 | g11383.t7 | exon | g11383.t7.exon3 | 15879520 | 15879709 |
| chr_1 | g11383 | g11383.t7 | cds | g11383.t7.CDS3 | 15879520 | 15879697 |
| chr_1 | g11383 | g11383.t7 | TSS | g11383.t7 | NA | NA |
>g11383.t7 Gene=g11383 Length=420
GAAGCTTTCAATATGATTGATCAAAATCGCGATGGATTCATTGAAAAAGAAGATCTTCAT
GATATGCTTGCTTCACTTGGAAAGAATCCAACAGATGACTATTTGGAGTCAATGATGAAT
GAAGCTCCTGGTCCAATTAATTTTACAATGTTTCTCACTTTATTTGGAGAAAGATTACAA
GGCAAGAATTACCCTGAAGATGTAATTAAAAATGCATTCGGATGCTTTGATGAAGACAAT
AATGGCCATATTTCTGAGGATCGTCTGAGAGAGTTATTAACTACAATGGGTGATCGTTTT
ACTGATGAAGAGGTTGACGAAATGTATCGTGAAGCGCCAATTAAAAACAATCTTTTTGAC
TATATCGAATTCACAAGAATCTTAAAACATGGCGCTAAAGACAATGAGAATGAACAATAA
>g11383.t7 Gene=g11383 Length=135
MIDQNRDGFIEKEDLHDMLASLGKNPTDDYLESMMNEAPGPINFTMFLTLFGERLQGKNY
PEDVIKNAFGCFDEDNNGHISEDRLRELLTTMGDRFTDEEVDEMYREAPIKNNLFDYIEF
TRILKHGAKDNENEQ
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 10 | g11383.t7 | Gene3D | G3DSA:1.10.238.10 | - | 1 | 56 | 3.1E-16 |
| 9 | g11383.t7 | Gene3D | G3DSA:1.10.238.10 | - | 60 | 125 | 5.8E-18 |
| 3 | g11383.t7 | PANTHER | PTHR23049 | MYOSIN REGULATORY LIGHT CHAIN 2 | 1 | 132 | 2.0E-67 |
| 4 | g11383.t7 | PANTHER | PTHR23049:SF66 | MYOSIN REGULATORY LIGHT POLYPEPTIDE 9 | 1 | 132 | 2.0E-67 |
| 1 | g11383.t7 | Pfam | PF13202 | EF hand | 1 | 16 | 0.0088 |
| 2 | g11383.t7 | Pfam | PF13202 | EF hand | 66 | 83 | 0.12 |
| 8 | g11383.t7 | ProSitePatterns | PS00018 | EF-hand calcium-binding domain. | 3 | 15 | - |
| 12 | g11383.t7 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 1 | 25 | 11.668 |
| 11 | g11383.t7 | ProSiteProfiles | PS50222 | EF-hand calcium-binding domain profile. | 60 | 95 | 11.473 |
| 6 | g11383.t7 | SMART | SM00054 | efh_1 | 1 | 22 | 8.6 |
| 7 | g11383.t7 | SMART | SM00054 | efh_1 | 64 | 92 | 0.28 |
| 5 | g11383.t7 | SUPERFAMILY | SSF47473 | EF-hand | 1 | 126 | 1.11E-33 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005509 | calcium ion binding | MF |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed