| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11385 | g11385.t1 | TTS | g11385.t1 | 15890382 | 15890382 |
| chr_1 | g11385 | g11385.t1 | isoform | g11385.t1 | 15890503 | 15890889 |
| chr_1 | g11385 | g11385.t1 | exon | g11385.t1.exon1 | 15890503 | 15890889 |
| chr_1 | g11385 | g11385.t1 | cds | g11385.t1.CDS1 | 15890503 | 15890889 |
| chr_1 | g11385 | g11385.t1 | TSS | g11385.t1 | 15891138 | 15891138 |
>g11385.t1 Gene=g11385 Length=387
ATGCAGATCTTCGTCAAAACACTAACAGGCAAGACCATTACACTTGAGGTCGAGCCATCT
GATACAATTGAAAATGTTAAGGCAAAGATTCAAGATAAAGAGGGAATTCCTCCAGATCAA
CAGCGTTTAATTTTTGCTGGTAAGCAATTGGAAGATGGACGAACATTGAGCGATTACAAC
ATTCAAAAGGAATCAACATTGCACTTGGTCCTTCGTCTTCGTGGTGGTATCATTGAACCA
TCATTGCGTATTTTGGCTCAAAAATACAATTGCGATAAAATGATTTGCCGTAAGTGCTAT
GCTCGCTTACATCCTCGTGCAACTAATTGTCGTAAAACAAAGTGCGGACACACAAATAAT
TTGCGTCCAAAGAAGAAGCTGAAGTAA
>g11385.t1 Gene=g11385 Length=128
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRILAQKYNCDKMICRKCYARLHPRATNCRKTKCGHTNN
LRPKKKLK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 11 | g11385.t1 | CDD | cd01803 | Ubl_ubiquitin | 1 | 76 | 2.1613E-56 |
| 9 | g11385.t1 | Gene3D | G3DSA:3.10.20.90 | - | 1 | 77 | 5.6E-45 |
| 10 | g11385.t1 | Gene3D | G3DSA:2.20.28.70 | - | 78 | 128 | 3.6E-33 |
| 3 | g11385.t1 | PANTHER | PTHR10666 | UBIQUITIN | 1 | 125 | 1.3E-73 |
| 4 | g11385.t1 | PANTHER | PTHR10666:SF368 | UBIQUITIN-60S RIBOSOMAL PROTEIN L40 | 1 | 125 | 1.3E-73 |
| 7 | g11385.t1 | PRINTS | PR00348 | Ubiquitin signature | 11 | 31 | 4.1E-39 |
| 6 | g11385.t1 | PRINTS | PR00348 | Ubiquitin signature | 32 | 52 | 4.1E-39 |
| 5 | g11385.t1 | PRINTS | PR00348 | Ubiquitin signature | 53 | 74 | 4.1E-39 |
| 1 | g11385.t1 | Pfam | PF00240 | Ubiquitin family | 3 | 74 | 1.5E-34 |
| 2 | g11385.t1 | Pfam | PF01020 | Ribosomal L40e family | 78 | 127 | 1.0E-31 |
| 12 | g11385.t1 | ProSitePatterns | PS00299 | Ubiquitin domain signature. | 27 | 52 | - |
| 15 | g11385.t1 | ProSiteProfiles | PS50053 | Ubiquitin domain profile. | 1 | 76 | 31.018 |
| 14 | g11385.t1 | SMART | SM00213 | ubq_7 | 1 | 72 | 2.9E-36 |
| 13 | g11385.t1 | SMART | SM01377 | Ribosomal_L40e_3 | 77 | 128 | 1.3E-32 |
| 8 | g11385.t1 | SUPERFAMILY | SSF54236 | Ubiquitin-like | 1 | 96 | 1.66E-35 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0005515 | protein binding | MF |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.