General information for g11389.t1
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been not been annotated.
Parent gene
- The parent gene g11389 is located on chr_1: 15901540..15901976 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11389 | g11389.t1 | TSS | g11389.t1 | 15901446 | 15901446 |
| chr_1 | g11389 | g11389.t1 | isoform | g11389.t1 | 15901540 | 15901976 |
| chr_1 | g11389 | g11389.t1 | exon | g11389.t1.exon1 | 15901540 | 15901558 |
| chr_1 | g11389 | g11389.t1 | cds | g11389.t1.CDS1 | 15901540 | 15901558 |
| chr_1 | g11389 | g11389.t1 | exon | g11389.t1.exon2 | 15901738 | 15901976 |
| chr_1 | g11389 | g11389.t1 | cds | g11389.t1.CDS2 | 15901738 | 15901976 |
| chr_1 | g11389 | g11389.t1 | TTS | g11389.t1 | 15902901 | 15902901 |
Sequences
>g11389.t1 Gene=g11389 Length=258
ATGAAAATTAAAGTAAAAAGTTGGACCAGTGTTGCTTGGTGGAAATGGATCGCAAATGAT
GAGAACTGTGGTATTTGTCGTATGGCCTTTGAAAATTGTTGTCCTGACTGTTCATTTGCT
GGGGACGATTGCCCTTTAGTTTGGGGTCATTGCTCACACGTCTTTCATATGCATTGCATT
TGTAAATGGCTTAATTCTCAACTTAATCAACAATTGTGCCCAATGTGCAGACAAACTTGG
CGTTTTAATGATAGATAA
>g11389.t1 Gene=g11389 Length=85
MKIKVKSWTSVAWWKWIANDENCGICRMAFENCCPDCSFAGDDCPLVWGHCSHVFHMHCI
CKWLNSQLNQQLCPMCRQTWRFNDR
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g11389.t1 | CDD | cd16456 | RING-H2_APC11 | 20 | 82 | 0.000 |
| 5 | g11389.t1 | Gene3D | G3DSA:3.30.40.10 | Zinc/RING finger domain | 1 | 84 | 0.000 |
| 2 | g11389.t1 | PANTHER | PTHR11210 | RING BOX | 2 | 84 | 0.000 |
| 3 | g11389.t1 | PANTHER | PTHR11210:SF1 | ANAPHASE-PROMOTING COMPLEX SUBUNIT 11 | 2 | 84 | 0.000 |
| 1 | g11389.t1 | Pfam | PF12861 | Anaphase-promoting complex subunit 11 RING-H2 finger | 1 | 83 | 0.000 |
| 6 | g11389.t1 | ProSiteProfiles | PS50089 | Zinc finger RING-type profile. | 34 | 77 | 10.512 |
| 4 | g11389.t1 | SUPERFAMILY | SSF57850 | RING/U-box | 1 | 83 | 0.000 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0061630 | ubiquitin protein ligase activity | MF |
| GO:0031145 | anaphase-promoting complex-dependent catabolic process | BP |
| GO:0008270 | zinc ion binding | MF |
| GO:0097602 | cullin family protein binding | MF |
| GO:0005680 | anaphase-promoting complex | CC |
KEGG
Orthology
- This transcript has been annotated with K03358 (anaphase-promoting complex subunit 11)
Pathway
- This transcript belongs to the following pathways
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
