Gene loci information

Transcript annotation

  • This transcript has been annotated as Proton-coupled amino acid transporter-like protein CG1139.

Parent gene

Gene structure

  • The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.

Chromosome Gene Transcript Category ID Start End
chr_1 g11397 g11397.t1 TSS g11397.t1 15955910 15955910
chr_1 g11397 g11397.t1 isoform g11397.t1 15956515 15958605
chr_1 g11397 g11397.t1 exon g11397.t1.exon1 15956515 15956576
chr_1 g11397 g11397.t1 cds g11397.t1.CDS1 15956515 15956576
chr_1 g11397 g11397.t1 exon g11397.t1.exon2 15956645 15956802
chr_1 g11397 g11397.t1 cds g11397.t1.CDS2 15956645 15956802
chr_1 g11397 g11397.t1 exon g11397.t1.exon3 15956867 15957028
chr_1 g11397 g11397.t1 cds g11397.t1.CDS3 15956867 15957028
chr_1 g11397 g11397.t1 exon g11397.t1.exon4 15957092 15957155
chr_1 g11397 g11397.t1 cds g11397.t1.CDS4 15957092 15957155
chr_1 g11397 g11397.t1 exon g11397.t1.exon5 15957268 15957436
chr_1 g11397 g11397.t1 cds g11397.t1.CDS5 15957268 15957436
chr_1 g11397 g11397.t1 exon g11397.t1.exon6 15957513 15957690
chr_1 g11397 g11397.t1 cds g11397.t1.CDS6 15957513 15957690
chr_1 g11397 g11397.t1 exon g11397.t1.exon7 15957757 15957813
chr_1 g11397 g11397.t1 cds g11397.t1.CDS7 15957757 15957813
chr_1 g11397 g11397.t1 exon g11397.t1.exon8 15957876 15958011
chr_1 g11397 g11397.t1 cds g11397.t1.CDS8 15957876 15958011
chr_1 g11397 g11397.t1 exon g11397.t1.exon9 15958074 15958243
chr_1 g11397 g11397.t1 cds g11397.t1.CDS9 15958074 15958243
chr_1 g11397 g11397.t1 exon g11397.t1.exon10 15958308 15958492
chr_1 g11397 g11397.t1 cds g11397.t1.CDS10 15958308 15958492
chr_1 g11397 g11397.t1 exon g11397.t1.exon11 15958546 15958605
chr_1 g11397 g11397.t1 cds g11397.t1.CDS11 15958546 15958605
chr_1 g11397 g11397.t1 TTS g11397.t1 15959219 15959219

Sequences

>g11397.t1 Gene=g11397 Length=1401
ATGTCTGCAGAAAAAGGGCATATCAATCCAGCATTTAATGATGAACACGAAACAAATATC
ACATACTCAAATGTCCGAAAAAAGGATTTTGGTATGGAGATGAAGGGTAAACATGAGATC
TCTAAAGATGATTACGAGCCTTATAAGAATAGAAATGTTGAACATCCGACTACCAACTGG
GAGACATTTTTTCATTTGATGAAAGGTAGCTTAGGAACTGGGATTCTTGCTATGGCTAAT
GCCTTTAATGATGCTGGATATGTAGTTGGATGCATAGGAACAATCATAATTGGAGTACTT
TGTACATACTGTATTCATCAATTAATCAGTGCTGAATATGAGTTGTGCAAGAGAAAAAGA
GTACCAAGTTTAACCTACGTAGGAGTAACTGAAGCGGCGCTATTAGAAGGGCCAAAATGC
TTAAAACGTTTCTCAAGGCAAAGTGTCTACGTAGTGAATATTTTTCTCGTTATATATCAG
TTAGGGACATGTTGCGTATATGTTGTTTTTGTAGCTTCAAATATTAAACGCATAACTGAT
CTCCATACAGAAGAAGAAACTGATGTGAGGCTAATAATGCTATTCTTACTACTACCTCTA
ATTTTTCTCAATTGGATTCGTAATCTTAAATTCCTCGCACCATTTTCAACTTTTGCCAAT
TTTGTTACGTTAGTGTCATTTGGCCTTATTCTTTATTTCATTTTTGAAAAGCCATTTACA
TTAGAAGATAAGCATGCTTTCGCCTCTATTAAATCATTTCCATTATTCTTTGGAACTGTC
CTTTTTGCACTTGAGGCTATCGGAGTTATTTTACCATTAGAAAATGAAATGAAAACACCA
AAAGCTTTTGCTTCGAAATTTGGTGTTCTAAATCAAGCGATGATCATCATCATTGTTTTG
TATGTTGGCATGGGATTGTTTGGCTATTTGCGTTTTGGAACAGATGTTTTAGGTTCAATT
ACTTTAAATCTTCCTACCAATGATATAAAAGCACAATTAGTTCAGGGAATGTTAGCTTTT
GCTATATTCATCTCACATGGGTTAGCCTGTTATGTTGCTATTGATATTATTTGGAATAAT
TATTTAAGTCACAAAGTGACTTCGTCTAAACGATTTTGGGAATACATTACTCGTACACTT
TTAGTTTTTGTCACATTTTTATTAGCTGTTGCCATCCCAAATTTAGAATTGTTTATCTCT
CTTTTTGGTGCTCTATGCTTATCAGCTCTTGGCCTAGCTTTCCCAGCTTTAATTGAAACA
TGTGTATACTGGAACACAACACATGGATTTCAAAAAGCAATAATGATTACAAAAAATACC
ATTATAATCATTCTTTCACTTGTTGGCTTATTGAGTGGAACATTCACCAGCTTGAAAGAA
ATTATTCATACATTCTTCTAG

>g11397.t1 Gene=g11397 Length=466
MSAEKGHINPAFNDEHETNITYSNVRKKDFGMEMKGKHEISKDDYEPYKNRNVEHPTTNW
ETFFHLMKGSLGTGILAMANAFNDAGYVVGCIGTIIIGVLCTYCIHQLISAEYELCKRKR
VPSLTYVGVTEAALLEGPKCLKRFSRQSVYVVNIFLVIYQLGTCCVYVVFVASNIKRITD
LHTEEETDVRLIMLFLLLPLIFLNWIRNLKFLAPFSTFANFVTLVSFGLILYFIFEKPFT
LEDKHAFASIKSFPLFFGTVLFALEAIGVILPLENEMKTPKAFASKFGVLNQAMIIIIVL
YVGMGLFGYLRFGTDVLGSITLNLPTNDIKAQLVQGMLAFAIFISHGLACYVAIDIIWNN
YLSHKVTSSKRFWEYITRTLLVFVTFLLAVAIPNLELFISLFGALCLSALGLAFPALIET
CVYWNTTHGFQKAIMITKNTIIIILSLVGLLSGTFTSLKEIIHTFF

Protein features from InterProScan

Transcript Database ID Name Start End E.value
2 g11397.t1 PANTHER PTHR22950:SF340 GLUTAMATE TRANSPORTER POLYPHEMUS-RELATED 32 465 3.3E-179
3 g11397.t1 PANTHER PTHR22950 AMINO ACID TRANSPORTER 32 465 3.3E-179
1 g11397.t1 Pfam PF01490 Transmembrane amino acid transporter protein 55 454 8.0E-68
20 g11397.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 1 84 -
29 g11397.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 85 109 -
15 g11397.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 110 148 -
27 g11397.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 149 169 -
24 g11397.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 170 188 -
25 g11397.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 189 206 -
17 g11397.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 207 217 -
28 g11397.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 218 235 -
19 g11397.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 236 254 -
30 g11397.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 255 273 -
18 g11397.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 274 292 -
34 g11397.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 293 312 -
23 g11397.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 313 331 -
26 g11397.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 332 354 -
14 g11397.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 355 374 -
31 g11397.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 375 392 -
21 g11397.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 393 397 -
32 g11397.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 398 418 -
16 g11397.t1 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. 419 438 -
33 g11397.t1 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane. 439 458 -
22 g11397.t1 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. 459 466 -
8 g11397.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 88 110 -
7 g11397.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 149 171 -
5 g11397.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 189 206 -
12 g11397.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 213 235 -
4 g11397.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 255 274 -
6 g11397.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 287 309 -
9 g11397.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 332 354 -
11 g11397.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 375 392 -
10 g11397.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 396 418 -
13 g11397.t1 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane. 439 458 -

Transmembrane regions from TMHMM

Disordered region

IUPRED3 score over 0.5 is predictive of a disordered region.

GO terms from InterProScan

There are no GO annotations for this transcript.

KEGG

Orthology

Pathway

  • This transcript belongs to the following pathways

Expression

Transcript expression in Pv11 cells

TPM values are indicated as average +/- STDEV.

Differential expression

Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed