General information for g11431.t10
Yuki Yoshida
22/1/2022
Gene loci information
Transcript annotation
- This transcript has been annotated as Putative 40S ribosomal protein S15.
Parent gene
- The parent gene g11431 is located on chr_1: 16196226..16199772 (+ strand)
Gene structure
- The exon-intron structure of all isoforms are indicated below. CDS regions are colored in green. TSS and TTs that were predicted with CTR-Seq data are indicated in solid circle and squares, respectively. More specific data are shown in the table below.
| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11431 | g11431.t10 | isoform | g11431.t10 | 16195309 | 16195945 |
| chr_1 | g11431 | g11431.t10 | exon | g11431.t10.exon1 | 16195309 | 16195318 |
| chr_1 | g11431 | g11431.t10 | exon | g11431.t10.exon2 | 16195538 | 16195576 |
| chr_1 | g11431 | g11431.t10 | cds | g11431.t10.CDS1 | 16195568 | 16195576 |
| chr_1 | g11431 | g11431.t10 | exon | g11431.t10.exon3 | 16195640 | 16195945 |
| chr_1 | g11431 | g11431.t10 | cds | g11431.t10.CDS2 | 16195640 | 16195945 |
| chr_1 | g11431 | g11431.t10 | TTS | g11431.t10 | 16196443 | 16196443 |
| chr_1 | g11431 | g11431.t10 | TSS | g11431.t10 | NA | NA |
Sequences
>g11431.t10 Gene=g11431 Length=355
ATTTGATCAGAGTTCGTGAAATAATTGTGTTATCGAAATCATGGCTGATGCTCAAGAAGA
ACAAGTTCGCAAGAAGCGTACCTTCCGTAAATTTACATATCGTGGAGTTGATTTAGATCA
ACTTTTGGATATGCCAAATGAACAACTCTCAGAGTTGATGCATAGTCGTGCTCGTCGTCG
TTTTGCTCGTGGATTGAAACGCAAACCAATGGCTTTAATCCAAAAGTTGCGAAAGGCAAA
GAAAGAGGCACCTCCACTTGAGAAGCCAGCTATTGTTAAGACTCATTTGCGTGACATGAT
CATTGTACCCGAAATGGTTGGATCAATCGTCGGTATCTATAATGGAAAAACATTC
>g11431.t10 Gene=g11431 Length=105
MADAQEEQVRKKRTFRKFTYRGVDLDQLLDMPNEQLSELMHSRARRRFARGLKRKPMALI
QKLRKAKKEAPPLEKPAIVKTHLRDMIIVPEMVGSIVGIYNGKTF
Protein features from InterProScan
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 7 | g11431.t10 | Gene3D | G3DSA:3.30.860.20 | - | 1 | 102 | 0.0e+00 |
| 2 | g11431.t10 | PANTHER | PTHR11880 | RIBOSOMAL PROTEIN S19P FAMILY MEMBER | 3 | 105 | 0.0e+00 |
| 3 | g11431.t10 | PANTHER | PTHR11880:SF2 | 40S RIBOSOMAL PROTEIN S15 | 3 | 105 | 0.0e+00 |
| 5 | g11431.t10 | PRINTS | PR00975 | Ribosomal protein S19 family signature | 81 | 100 | 5.6e-05 |
| 4 | g11431.t10 | PRINTS | PR00975 | Ribosomal protein S19 family signature | 101 | 105 | 5.6e-05 |
| 1 | g11431.t10 | Pfam | PF00203 | Ribosomal protein S19 | 46 | 105 | 0.0e+00 |
| 6 | g11431.t10 | SUPERFAMILY | SSF54570 | Ribosomal protein S19 | 52 | 105 | 0.0e+00 |
Transmembrane regions from TMHMM
Disordered region
IUPRED3 score over 0.5 is predictive of a disordered region.
GO terms from InterProScan
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
KEGG
Orthology
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
Expression
Transcript expression in Pv11 cells
TPM values are indicated as average +/- STDEV. 
Differential expression
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below.
