| Chromosome | Gene | Transcript | Category | ID | Start | End |
|---|---|---|---|---|---|---|
| chr_1 | g11431 | g11431.t11 | isoform | g11431.t11 | 16195309 | 16196344 |
| chr_1 | g11431 | g11431.t11 | exon | g11431.t11.exon1 | 16195309 | 16195327 |
| chr_1 | g11431 | g11431.t11 | exon | g11431.t11.exon2 | 16195608 | 16195951 |
| chr_1 | g11431 | g11431.t11 | cds | g11431.t11.CDS1 | 16195721 | 16195951 |
| chr_1 | g11431 | g11431.t11 | exon | g11431.t11.exon3 | 16196219 | 16196344 |
| chr_1 | g11431 | g11431.t11 | cds | g11431.t11.CDS2 | 16196219 | 16196344 |
| chr_1 | g11431 | g11431.t11 | TTS | g11431.t11 | 16196443 | 16196443 |
| chr_1 | g11431 | g11431.t11 | TSS | g11431.t11 | NA | NA |
>g11431.t11 Gene=g11431 Length=489
ATTTGATCAGGTTGGTTCTGATTAAAATAATAGTGAAAATATTTTTTTCAGGCTCAAGAA
GAACAAGTTCGCAAGAAGCGTACCTTCCGTAAATTTACATATCGTGGAGTTGATTTAGAT
CAACTTTTGGATATGCCAAATGAACAACTCTCAGAGTTGATGCATAGTCGTGCTCGTCGT
CGTTTTGCTCGTGGATTGAAACGCAAACCAATGGCTTTAATCCAAAAGTTGCGAAAGGCA
AAGAAAGAGGCACCTCCACTTGAGAAGCCAGCTATTGTTAAGACTCATTTGCGTGACATG
ATCATTGTACCCGAAATGGTTGGATCAATCGTCGGTATCTATAATGGAAAAACATTCAAT
CAAGTTGAAATCAAGCCAGAAATGATTGGACACTATTTAGGAGACTTTTCGCTCACATAT
AAACCAGTTAAGCATGGTCGTCCCGGTATTGGTGCCACGCACAGTTCACGATTTATTCCA
TTAAAGTAA
>g11431.t11 Gene=g11431 Length=118
MPNEQLSELMHSRARRRFARGLKRKPMALIQKLRKAKKEAPPLEKPAIVKTHLRDMIIVP
EMVGSIVGIYNGKTFNQVEIKPEMIGHYLGDFSLTYKPVKHGRPGIGATHSSRFIPLK
| Transcript | Database | ID | Name | Start | End | E.value | |
|---|---|---|---|---|---|---|---|
| 9 | g11431.t11 | Gene3D | G3DSA:3.30.860.20 | - | 1 | 118 | 4.3E-60 |
| 4 | g11431.t11 | Hamap | MF_00531 | 30S ribosomal protein S19 [rpsS]. | 14 | 107 | 21.446079 |
| 2 | g11431.t11 | PANTHER | PTHR11880:SF50 | LOW QUALITY PROTEIN: 40S RIBOSOMAL PROTEIN S15 | 2 | 118 | 1.6E-64 |
| 3 | g11431.t11 | PANTHER | PTHR11880 | RIBOSOMAL PROTEIN S19P FAMILY MEMBER | 2 | 118 | 1.6E-64 |
| 10 | g11431.t11 | PIRSF | PIRSF002144 | RPS19p_RPS19a_RPS15e_RPS19o | 5 | 118 | 1.6E-37 |
| 7 | g11431.t11 | PRINTS | PR00975 | Ribosomal protein S19 family signature | 51 | 70 | 4.4E-14 |
| 5 | g11431.t11 | PRINTS | PR00975 | Ribosomal protein S19 family signature | 71 | 83 | 4.4E-14 |
| 6 | g11431.t11 | PRINTS | PR00975 | Ribosomal protein S19 family signature | 83 | 98 | 4.4E-14 |
| 1 | g11431.t11 | Pfam | PF00203 | Ribosomal protein S19 | 16 | 101 | 2.3E-34 |
| 11 | g11431.t11 | ProSitePatterns | PS00323 | Ribosomal protein S19 signature. | 71 | 95 | - |
| 8 | g11431.t11 | SUPERFAMILY | SSF54570 | Ribosomal protein S19 | 22 | 102 | 5.1E-31 |
| 12 | g11431.t11 | TIGRFAM | TIGR01025 | uS19_arch: ribosomal protein uS19 | 1 | 118 | 4.2E-59 |
IUPRED3 score over 0.5 is predictive of a disordered region.
| GOID | TERM | ONTOLOGY |
|---|---|---|
| GO:0005840 | ribosome | CC |
| GO:0003723 | RNA binding | MF |
| GO:0006412 | translation | BP |
| GO:0003735 | structural constituent of ribosome | MF |
| GO:0015935 | small ribosomal subunit | CC |
This gene did not have any KEGG ortholog annotations (KAAS, GHOSTZ).
TPM values are indicated as average +/- STDEV.
Differentially expressed genes were identified with DESeq2 using the ‘run_DE_analysis.pl’ script from Trinity. Transcripts were determined as differentially expressed when (1) FDR < 0.05 (2) fold change > 2 (TPM calculated by RSEM). DE information and fold change between conditions are indicated in the plot below. There were no conditions that were differentially expressed